StarFunc result for job id P41732

User Input

>input (249 residues)
MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPY
VLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTF
LRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETD
CNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRF
ITANQYEMV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0BNE7	0.987	0.987	1.058E-33	249	0.980	0.980	B0BNE7.pdb.gz	B0BNE7_RAT Tetraspanin OS=Rattus norvegicus OX=10116 GN=Tspan7 PE=3 SV=1
2	AFDB:O43657	0.904	0.918	2.184E-23	245	0.586	0.596	O43657.pdb.gz	TSN6_HUMAN Tetraspanin-6 OS=Homo sapiens OX=9606 GN=TSPAN6 PE=1 SV=1
3	AFDB:A0A024RB05	0.831	0.867	5.184E-15	238	0.289	0.303	A0A024RB05.pdb.gz
4	AFDB:O60637	0.804	0.792	3.997E-14	253	0.333	0.328	O60637.pdb.gz	TSN3_HUMAN Tetraspanin-3 OS=Homo sapiens OX=9606 GN=TSPAN3 PE=2 SV=1
5	AFDB:P28648	0.836	0.872	5.574E-14	238	0.285	0.298	P28648.pdb.gz	CD63_RAT CD63 antigen OS=Rattus norvegicus OX=10116 GN=Cd63 PE=1 SV=2
6	AFDB:Q96FV3	0.754	0.702	2.108E-13	270	0.285	0.263	Q96FV3.pdb.gz	TSN17_HUMAN Tetraspanin-17 OS=Homo sapiens OX=9606 GN=TSPAN17 PE=2 SV=2
7	AFDB:P62079	0.787	0.736	4.507E-13	268	0.257	0.239	P62079.pdb.gz	TSN5_HUMAN Tetraspanin-5 OS=Homo sapiens OX=9606 GN=TSPAN5 PE=1 SV=1
8	AFDB:Q6P2T9	0.785	0.822	5.993E-13	237	0.281	0.295	Q6P2T9.pdb.gz	Q6P2T9_DANRE Tetraspanin OS=Danio rerio OX=7955 GN=cd163 PE=1 SV=1
9	AFDB:Q6NWG0	0.724	0.739	6.285E-13	243	0.273	0.280	Q6NWG0.pdb.gz	TSN36_DANRE Tetraspanin-36 OS=Danio rerio OX=7955 GN=tspan36 PE=1 SV=2
10	AFDB:Q86UF1	0.737	0.659	6.911E-13	283	0.269	0.237	Q86UF1.pdb.gz	TSN33_HUMAN Tetraspanin-33 OS=Homo sapiens OX=9606 GN=TSPAN33 PE=1 SV=1
11	PDB:6k4jA	0.612	0.683	5.683E-9	220	0.229	0.259	6k4jA.pdb.gz
12	PDB:6wvgA	0.659	0.385	3.295E-8	443	0.221	0.124	6wvgA.pdb.gz
13	PDB:7zw1A	0.458	0.385	9.161E-7	317	0.181	0.142	7zw1A.pdb.gz
14	PDB:5tcxA	0.545	0.636	6.423E-6	208	0.205	0.245	5tcxA.pdb.gz	Crystal Structure of a Full-Length Human Tetraspanin Reveals a Cholesterol-Binding Pocket.
15	PDB:7zw1B	0.381	0.323	3.472E-4	316	0.165	0.130	7zw1B.pdb.gz
16	PDB:6osaR	0.231	0.190	1.227	321	0.120	0.093	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
17	PDB:6uw9A	0.182	0.108	1.287	582	0.165	0.070	6uw9A.pdb.gz
18	PDB:6r7xA	0.183	0.095	1.484	629	0.100	0.040	6r7xA.pdb.gz	The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.
19	PDB:6co7A	0.189	0.068	1.882	1061	0.120	0.028	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
20	PDB:5wlcST	0.153	0.081	1.973	599	0.092	0.038	5wlcST.pdb.gz	The complete structure of the small-subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0BNE7	0.0	508	249	0.980	0.980	B0BNE7_RAT Tetraspanin OS=Rattus norvegicus OX=10116 GN=Tspan7 PE=3 SV=1
2	P41732	0.0	517	249	1.000	1.000	TSN7_HUMAN Tetraspanin-7 OS=Homo sapiens OX=9606 GN=TSPAN7 PE=1 SV=2
3	F1M8Y2	4.57e-157	436	221	0.867	0.977	F1M8Y2_RAT Tetraspanin OS=Rattus norvegicus OX=10116 GN=Tspan7 PE=3 SV=4
4	O43657	1.63e-105	307	245	0.586	0.596	TSN6_HUMAN Tetraspanin-6 OS=Homo sapiens OX=9606 GN=TSPAN6 PE=1 SV=1
5	P28648	1.37e-40	141	238	0.289	0.303	CD63_RAT CD63 antigen OS=Rattus norvegicus OX=10116 GN=Cd63 PE=1 SV=2
6	P08962	2.03e-39	138	238	0.301	0.315	CD63_HUMAN CD63 antigen OS=Homo sapiens OX=9606 GN=CD63 PE=1 SV=2
7	P41731	2.34e-39	138	238	0.285	0.298	CD63_MOUSE CD63 antigen OS=Mus musculus OX=10090 GN=Cd63 PE=1 SV=2
8	F8VWK8	3.02e-34	124	217	0.269	0.309	F8VWK8_HUMAN Tetraspanin (Fragment) OS=Homo sapiens OX=9606 GN=CD63 PE=1 SV=1
9	F8W022	3.91e-34	124	215	0.269	0.312	F8W022_HUMAN Tetraspanin (Fragment) OS=Homo sapiens OX=9606 GN=CD63 PE=1 SV=1
10	Q6P2T9	6.93e-33	121	237	0.289	0.304	Q6P2T9_DANRE Tetraspanin OS=Danio rerio OX=7955 GN=cd163 PE=1 SV=1
11	Q6NWG0	5.98e-32	119	243	0.273	0.280	TSN36_DANRE Tetraspanin-36 OS=Danio rerio OX=7955 GN=tspan36 PE=1 SV=2
12	O60637	2.22e-30	115	253	0.333	0.328	TSN3_HUMAN Tetraspanin-3 OS=Homo sapiens OX=9606 GN=TSPAN3 PE=2 SV=1
13	Q9D7W4	2.10e-29	113	270	0.289	0.267	TSN17_MOUSE Tetraspanin-17 OS=Mus musculus OX=10090 GN=Tspan17 PE=1 SV=1
14	Q96FV3	9.53e-29	111	270	0.285	0.263	TSN17_HUMAN Tetraspanin-17 OS=Homo sapiens OX=9606 GN=TSPAN17 PE=2 SV=2
15	P48509	6.56e-28	108	253	0.309	0.304	CD151_HUMAN CD151 antigen OS=Homo sapiens OX=9606 GN=CD151 PE=1 SV=3
16	P62079	9.51e-28	108	268	0.261	0.243	TSN5_HUMAN Tetraspanin-5 OS=Homo sapiens OX=9606 GN=TSPAN5 PE=1 SV=1
17	P62080	9.51e-28	108	268	0.261	0.243	TSN5_MOUSE Tetraspanin-5 OS=Mus musculus OX=10090 GN=Tspan5 PE=1 SV=1
18	Q68VK5	9.51e-28	108	268	0.261	0.243	TSN5_RAT Tetraspanin-5 OS=Rattus norvegicus OX=10116 GN=Tspan5 PE=2 SV=2
19	Q8R3S2	9.18e-27	106	283	0.277	0.244	TSN33_MOUSE Tetraspanin-33 OS=Mus musculus OX=10090 GN=Tspan33 PE=1 SV=1
20	Q86UF1	2.92e-26	105	283	0.261	0.230	TSN33_HUMAN Tetraspanin-33 OS=Homo sapiens OX=9606 GN=TSPAN33 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04231 Endonuclease_1	1.8e+02	13.2	Endonuclease I
2	PF00335 Tetraspanin	2.5e-48	176.3	Tetraspanin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367743

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296526	0.944	Glutamate receptor 2
2	9606.ENSP00000385205	0.929	PRKCA-binding protein
3	9606.ENSP00000481554	0.922	Glutamate receptor 3
4	9606.ENSP00000428994	0.920	Glutamate receptor 1
5	9606.ENSP00000282499	0.915	Glutamate receptor 4
6	9606.ENSP00000381098	0.907	Glutamate receptor-interacting protein 1
7	9606.ENSP00000480660	0.904	Glutamate receptor-interacting protein 2
8	9606.ENSP00000347710	0.619	Oligophrenin-1
9	9606.ENSP00000250617	0.588	Rho guanine nucleotide exchange factor 6
10	9606.ENSP00000368278	0.542	Interleukin-1 receptor accessory protein-like 1
11	9606.ENSP00000359489	0.538	AF4/FMR2 family member 2
12	9606.ENSP00000352540	0.530	Epithelial membrane protein 2
13	9606.ENSP00000394071	0.521	Rab GDP dissociation inhibitor alpha
14	9606.ENSP00000379350	0.507	Integrin beta-1
15	9606.ENSP00000247461	0.501	Calnexin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0032879	0.896	regulation of localization
GO:0051049	0.826	regulation of transport
GO:0065008	0.787	regulation of biological quality
GO:0051128	0.702	regulation of cellular component organization
GO:0048259	0.671	regulation of receptor-mediated endocytosis
GO:0002090	0.648	regulation of receptor internalization
GO:0009987	0.623	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.811	membrane-bounded organelle
GO:0031982	0.336	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]