StarFunc result for job id P41743

User Input

>input (596 residues)
MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSF
DNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGE
DKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHK
KCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTR
ESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQ
TEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIR
IPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFK
PNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1M7Y5	0.943	0.943	0.000	596	0.987	0.987	F1M7Y5.pdb.gz	KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus OX=10116 GN=Prkci PE=1 SV=1
2	AFDB:Q90XF2	0.671	0.680	8.856E-102	588	0.884	0.896	Q90XF2.pdb.gz	KPCI_DANRE Protein kinase C iota type OS=Danio rerio OX=7955 GN=prkci PE=2 SV=2
3	AFDB:P09217	0.840	0.846	4.846E-91	592	0.715	0.720	P09217.pdb.gz	KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus OX=10116 GN=Prkcz PE=1 SV=2
4	AFDB:A1Z9X0	0.835	0.822	1.117E-89	606	0.671	0.660	A1Z9X0.pdb.gz	APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster OX=7227 GN=aPKC PE=1 SV=1
5	AFDB:B0S4T7	0.598	0.595	9.729E-89	599	0.715	0.711	B0S4T7.pdb.gz
6	AFDB:Q19266	0.757	0.756	1.191E-75	597	0.572	0.571	Q19266.pdb.gz	KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans OX=6239 GN=pkc-3 PE=1 SV=1
7	AFDB:H9G2Y7	0.550	0.431	1.941E-50	763	0.356	0.278	H9G2Y7.pdb.gz	H9G2Y7_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=1
8	AFDB:L7RTI5	0.549	0.445	2.993E-50	737	0.366	0.296	L7RTI5.pdb.gz	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
9	AFDB:B8A467	0.550	0.447	4.870E-50	738	0.357	0.289	B8A467.pdb.gz	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
10	AFDB:P13678	0.558	0.452	1.784E-49	739	0.376	0.303	P13678.pdb.gz	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
11	PDB:3pfqA	0.520	0.591	4.708E-37	523	0.292	0.333	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6byrA	0.494	0.718	1.253E-29	405	0.206	0.304	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
13	PDB:6pjxA	0.492	0.538	7.884E-29	543	0.191	0.210	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
14	PDB:6s9wA	0.426	0.604	1.593E-28	411	0.242	0.350	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
15	PDB:3nynA	0.494	0.530	2.592E-28	554	0.188	0.202	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
16	PDB:3pvuA	0.484	0.474	3.049E-28	609	0.173	0.169	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:4mk0A	0.494	0.468	4.219E-28	631	0.180	0.170	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:5x3fB	0.443	0.741	4.453E-28	349	0.195	0.332	5x3fB.pdb.gz
19	PDB:3c4wB	0.496	0.567	4.962E-28	519	0.183	0.210	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
20	PDB:4yhjA	0.510	0.602	8.997E-28	501	0.174	0.208	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z9X0	0.0	827	606	0.678	0.667	APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster OX=7227 GN=aPKC PE=1 SV=1
2	F1M7Y5	0.0	1230	596	0.987	0.987	KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus OX=10116 GN=Prkci PE=1 SV=1
3	P09217	0.0	889	592	0.710	0.715	KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus OX=10116 GN=Prkcz PE=1 SV=2
4	P41743	0.0	1249	596	1.000	1.000	KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens OX=9606 GN=PRKCI PE=1 SV=2
5	Q02956	0.0	881	592	0.706	0.711	KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus OX=10090 GN=Prkcz PE=1 SV=2
6	Q05513	0.0	884	592	0.720	0.725	KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens OX=9606 GN=PRKCZ PE=1 SV=4
7	Q19266	0.0	705	597	0.576	0.575	KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans OX=6239 GN=pkc-3 PE=1 SV=1
8	Q4JG04	0.0	890	599	0.706	0.703	Q4JG04_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=si:ch211-150o23.4 PE=2 SV=1
9	Q62074	0.0	1223	595	0.983	0.985	KPCI_MOUSE Protein kinase C iota type OS=Mus musculus OX=10090 GN=Prkci PE=1 SV=3
10	Q90XF2	0.0	1093	588	0.884	0.896	KPCI_DANRE Protein kinase C iota type OS=Danio rerio OX=7955 GN=prkci PE=2 SV=2
11	P34885	3.31e-139	422	707	0.366	0.308	KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=2
12	H9G2Y7	1.36e-138	423	763	0.366	0.286	H9G2Y7_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=1
13	B8A467	4.39e-136	416	738	0.364	0.294	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
14	P16054	1.82e-134	411	737	0.366	0.296	KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus OX=10090 GN=Prkce PE=1 SV=1
15	L7RTI5	2.10e-134	411	737	0.372	0.301	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
16	Q02156	2.10e-134	411	737	0.372	0.301	KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=1 SV=1
17	P09216	3.67e-133	408	737	0.366	0.296	KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus OX=10116 GN=Prkce PE=1 SV=1
18	P13678	3.04e-131	403	739	0.352	0.284	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
19	P23298	1.03e-129	397	683	0.332	0.290	KPCL_MOUSE Protein kinase C eta type OS=Mus musculus OX=10090 GN=Prkch PE=1 SV=2
20	Q64617	1.89e-129	397	683	0.332	0.290	KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus OX=10116 GN=Prkch PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	70	14.0	ABC1 atypical kinase-like domain
2	PF01636 APH	55	15.1	Phosphotransferase enzyme family
3	PF00130 C1_1	2e-11	54.9	Phorbol esters/diacylglycerol binding domain (C1 domain)
4	PF03107 C1_2	59	15.4	C1 domain
5	PF12330 Haspin_kinase	3.2e+02	11.7	Haspin like kinase domain
6	PF06293 Kdo	48	14.8	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF14531 Kinase-like	0.18	22.7	Kinase-like
8	PF00564 PB1	1.6e-11	55.3	PB1 domain
9	PF00069 Pkinase	2.5e-64	228.8	Protein kinase domain
10	PF00433 Pkinase_C	0.079	25.0	Protein kinase C terminal domain
11	PF07714 PK_Tyr_Ser-Thr	5.2e-31	119.5	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295797

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219255	0.999	Partitioning defective 6 homolog alpha
2	9606.ENSP00000363921	0.999	Partitioning defective 3 homolog
3	9606.ENSP00000360672	0.998	Partitioning defective 6 homolog beta
4	9606.ENSP00000374455	0.998	Sequestosome-1
5	9606.ENSP00000376333	0.998	Lethal(2) giant larvae protein homolog 2
6	9606.ENSP00000321537	0.996	Lethal(2) giant larvae protein homolog 1
7	9606.ENSP00000343144	0.994	Partitioning defective 6 homolog gamma
8	9606.ENSP00000451300	0.991	Protein numb homolog
9	9606.ENSP00000383118	0.984	Cell division control protein 42 homolog
10	9606.ENSP00000367830	0.974	Protein kinase C zeta type
11	9606.ENSP00000344456	0.968	Catenin beta-1
12	9606.ENSP00000433623	0.963	TNF receptor-associated factor 6
13	9606.ENSP00000344220	0.951	3-phosphoinositide-dependent protein kinase 1
14	9606.ENSP00000359424	0.945	Inhibitor of nuclear factor kappa-B kinase subunit alpha
15	9606.ENSP00000304669	0.938	Catenin alpha-1
16	9606.ENSP00000352673	0.938	ETS-related transcription factor Elf-3
17	9606.ENSP00000320935	0.937	Solute carrier family 2, facilitated glucose transporter member 4
18	9606.ENSP00000238738	0.934	Rho-related GTP-binding protein RhoQ
19	9606.ENSP00000261769	0.932	Cadherin-1
20	9606.ENSP00000362680	0.930	Proto-oncogene tyrosine-protein kinase Src

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0004697	0.989	protein kinase C activity
GO:0019899	0.575	enzyme binding
GO:0097159	0.515	organic cyclic compound binding
GO:1901363	0.511	heterocyclic compound binding
GO:0019900	0.380	kinase binding
GO:0098772	0.340	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.976	response to stimulus
GO:0048518	0.939	positive regulation of biological process
GO:0071840	0.937	cellular component organization or biogenesis
GO:0008152	0.915	metabolic process
GO:0071704	0.902	organic substance metabolic process
GO:0044238	0.902	primary metabolic process
GO:0032501	0.889	multicellular organismal process
GO:0006807	0.886	nitrogen compound metabolic process
GO:0036211	0.868	protein modification process
GO:0044237	0.860	cellular metabolic process
GO:0032502	0.855	developmental process
GO:0048856	0.848	anatomical structure development
GO:0048522	0.830	positive regulation of cellular process
GO:0051716	0.822	cellular response to stimulus
GO:0060255	0.810	regulation of macromolecule metabolic process
GO:0051179	0.760	localization
GO:0023052	0.738	signaling
GO:0016043	0.736	cellular component organization
GO:0007154	0.704	cell communication
GO:0031323	0.699	regulation of cellular metabolic process
GO:0006796	0.696	phosphate-containing compound metabolic process
GO:0007165	0.693	signal transduction
GO:0007163	0.690	establishment or maintenance of cell polarity
GO:0048519	0.654	negative regulation of biological process
GO:0016310	0.627	phosphorylation
GO:0080090	0.605	regulation of primary metabolic process
GO:0051171	0.604	regulation of nitrogen compound metabolic process
GO:0051641	0.595	cellular localization
GO:0006468	0.592	protein phosphorylation
GO:0042221	0.561	response to chemical
GO:0048583	0.506	regulation of response to stimulus
GO:0010468	0.471	regulation of gene expression
GO:0010604	0.466	positive regulation of macromolecule metabolic process
GO:0023051	0.464	regulation of signaling
GO:0048523	0.464	negative regulation of cellular process
GO:0070887	0.462	cellular response to chemical stimulus
GO:0007275	0.457	multicellular organism development
GO:0065009	0.454	regulation of molecular function
GO:0009966	0.447	regulation of signal transduction
GO:0010556	0.420	regulation of macromolecule biosynthetic process
GO:0031326	0.420	regulation of cellular biosynthetic process
GO:0032879	0.416	regulation of localization
GO:0071310	0.415	cellular response to organic substance
GO:0019219	0.410	regulation of nucleobase-containing compound metabolic process
GO:0048513	0.392	animal organ development
GO:1902531	0.388	regulation of intracellular signal transduction
GO:0031325	0.361	positive regulation of cellular metabolic process
GO:0051252	0.357	regulation of RNA metabolic process
GO:0061245	0.355	establishment or maintenance of bipolar cell polarity
GO:0006996	0.351	organelle organization
GO:0009719	0.337	response to endogenous stimulus
GO:0051173	0.337	positive regulation of nitrogen compound metabolic process
GO:0051246	0.334	regulation of protein metabolic process
GO:0051239	0.329	regulation of multicellular organismal process
GO:1903506	0.325	regulation of nucleic acid-templated transcription
GO:0006355	0.324	regulation of DNA-templated transcription
GO:0048731	0.322	system development
GO:0051128	0.315	regulation of cellular component organization
GO:0009967	0.315	positive regulation of signal transduction
GO:0030154	0.303	cell differentiation
GO:0044093	0.300	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0005829	0.982	cytosol
GO:0043227	0.959	membrane-bounded organelle
GO:0043229	0.936	intracellular organelle
GO:0043231	0.889	intracellular membrane-bounded organelle
GO:0030054	0.840	cell junction
GO:0031982	0.829	vesicle
GO:0032991	0.810	protein-containing complex
GO:0005576	0.786	extracellular region
GO:0043230	0.742	extracellular organelle
GO:1903561	0.699	extracellular vesicle
GO:0005634	0.663	nucleus
GO:0070062	0.639	extracellular exosome
GO:0070161	0.586	anchoring junction
GO:0031981	0.470	nuclear lumen
GO:0005911	0.413	cell-cell junction
GO:0043296	0.402	apical junction complex
GO:0043228	0.365	non-membrane-bounded organelle
GO:0043232	0.345	intracellular non-membrane-bounded organelle
GO:0098590	0.344	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.13	0.989	protein kinase C.

[back to server]