StarFunc result for job id P41970

User Input

>input (407 residues)
MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLS
RALRYYYDKNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGRE
AHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVR
TVIRFVTNKTDKHVTRPVVSLPSTSEAAAASAFLASSVSAKISSLMLPNAASISSASPFS
SRSPSLSPNSPLPSEHRSLFLEAACHDSDSLEPLNLSSGSKTKSPSLPPKAKKPKGLEIS
APPLVLSGTDIGSIALNSPALPSGSLTPAFFTAQTPNGLLLTPSPLLSSIHFWSSLSPVA
PLSPARLQGPSTLFQFPTLLNGHMPVPIPSLDRAASPVLLSSNSQKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41971	0.510	0.509	9.735E-56	409	0.924	0.919	P41971.pdb.gz	ELK3_MOUSE ETS domain-containing protein Elk-3 OS=Mus musculus OX=10090 GN=Elk3 PE=2 SV=3
2	AFDB:A0A024R985	0.334	0.318	1.797E-31	431	0.533	0.503	A0A024R985.pdb.gz
3	AFDB:A0A024R1A7	0.283	0.270	9.157E-23	428	0.393	0.374	A0A024R1A7.pdb.gz
4	AFDB:P41969	0.363	0.347	7.504E-22	429	0.393	0.373	P41969.pdb.gz	ELK1_MOUSE ETS domain-containing protein Elk-1 OS=Mus musculus OX=10090 GN=Elk1 PE=1 SV=3
5	AFDB:G5EDL0	0.213	0.197	1.630E-14	441	0.285	0.263	G5EDL0.pdb.gz	G5EDL0_CAEEL ETS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lin-1 PE=2 SV=1
6	AFDB:Q99607	0.218	0.135	6.911E-13	663	0.275	0.169	Q99607.pdb.gz	ELF4_HUMAN ETS-related transcription factor Elf-4 OS=Homo sapiens OX=9606 GN=ELF4 PE=1 SV=1
7	AFDB:Q9EQY2	0.206	0.148	2.573E-12	579	0.248	0.174	Q9EQY2.pdb.gz
8	AFDB:Q01842	0.251	0.144	4.354E-12	732	0.194	0.108	Q01842.pdb.gz	POK_DROME Ets DNA-binding protein pokkuri OS=Drosophila melanogaster OX=7227 GN=aop PE=1 SV=2
9	AFDB:G3V9V2	0.215	0.144	4.650E-12	615	0.251	0.166	G3V9V2.pdb.gz	G3V9V2_RAT E74 like ETS transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Elf1 PE=3 SV=1
10	AFDB:Q9EQY1	0.205	0.160	4.650E-12	524	0.248	0.193	Q9EQY1.pdb.gz
11	PDB:1ldjA	0.131	0.079	7.724E-2	725	0.025	0.014	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
12	PDB:5k1yD	0.105	0.360	1.307E-1	92	0.034	0.152	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
13	PDB:1r1uC	0.088	0.282	1.939E-1	98	0.037	0.153	1r1uC.pdb.gz
14	PDB:6w6wC	0.114	0.135	2.361E-1	323	0.029	0.037	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
15	PDB:6jmiA	0.093	0.324	5.197E-1	100	0.022	0.090	6jmiA.pdb.gz
16	PDB:3euhC	0.146	0.253	5.550E-1	206	0.044	0.087	3euhC.pdb.gz
17	PDB:2xv4S	0.108	0.110	6.330E-1	399	0.034	0.035	2xv4S.pdb.gz
18	PDB:3cuqA	0.124	0.207	6.760E-1	219	0.057	0.105	3cuqA.pdb.gz
19	PDB:4a0kA	0.116	0.072	7.709E-1	719	0.020	0.011	4a0kA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.
20	PDB:3m8eA	0.099	0.300	8.233E-1	101	0.017	0.069	3m8eA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P41970	0.0	813	407	1.000	1.000	ELK3_HUMAN ETS domain-containing protein Elk-3 OS=Homo sapiens OX=9606 GN=ELK3 PE=1 SV=2
2	P41971	0.0	651	409	0.916	0.912	ELK3_MOUSE ETS domain-containing protein Elk-3 OS=Mus musculus OX=10090 GN=Elk3 PE=2 SV=3
3	P28324	1.23e-103	315	431	0.541	0.510	ELK4_HUMAN ETS domain-containing protein Elk-4 OS=Homo sapiens OX=9606 GN=ELK4 PE=1 SV=3
4	A4GTP4	3.32e-55	190	427	0.236	0.225	ELK1_RAT ETS domain-containing protein Elk-1 OS=Rattus norvegicus OX=10116 GN=Elk1 PE=1 SV=1
5	P41969	1.31e-54	188	429	0.233	0.221	ELK1_MOUSE ETS domain-containing protein Elk-1 OS=Mus musculus OX=10090 GN=Elk1 PE=1 SV=3
6	P19419	4.57e-54	187	428	0.233	0.222	ELK1_HUMAN ETS domain-containing protein Elk-1 OS=Homo sapiens OX=9606 GN=ELK1 PE=1 SV=2
7	G5EDL0	1.41e-31	126	441	0.140	0.129	G5EDL0_CAEEL ETS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lin-1 PE=2 SV=1
8	P28322	2.17e-30	124	485	0.128	0.107	ETV4_MOUSE ETS translocation variant 4 OS=Mus musculus OX=10090 GN=Etv4 PE=2 SV=2
9	P43268	3.27e-30	123	484	0.128	0.107	ETV4_HUMAN ETS translocation variant 4 OS=Homo sapiens OX=9606 GN=ETV4 PE=1 SV=3
10	B7Z5F4	3.33e-30	122	430	0.128	0.121	B7Z5F4_HUMAN ETS variant transcription factor 4 OS=Homo sapiens OX=9606 GN=ETV4 PE=1 SV=1
11	Q9PUQ1	1.42e-29	122	494	0.125	0.103	ETV4_DANRE ETS translocation variant 4 OS=Danio rerio OX=7955 GN=etv4 PE=1 SV=2
12	Q99581	8.05e-29	114	238	0.120	0.206	FEV_HUMAN Protein FEV OS=Homo sapiens OX=9606 GN=FEV PE=1 SV=1
13	F1Q6X6	9.16e-29	119	522	0.123	0.096	F1Q6X6_DANRE ETS translocation variant 5 isoform 2 OS=Danio rerio OX=7955 GN=etv5 PE=3 SV=3
14	D4AC56	1.05e-28	119	510	0.133	0.106	D4AC56_RAT ETS variant transcription factor 5 OS=Rattus norvegicus OX=10116 GN=Etv5 PE=3 SV=1
15	O70132	1.19e-28	114	237	0.120	0.207	FEV_RAT Protein FEV OS=Rattus norvegicus OX=10116 GN=Fev PE=2 SV=2
16	Q8QZW2	1.19e-28	114	237	0.120	0.207	FEV_MOUSE Protein FEV OS=Mus musculus OX=10090 GN=Fev PE=2 SV=1
17	Q22355	1.22e-28	117	377	0.118	0.127	AST1_CAEEL Transcription factor ast-1 OS=Caenorhabditis elegans OX=6239 GN=ast-1 PE=1 SV=2
18	A0A8I6AQT3	1.25e-28	119	528	0.133	0.102	A0A8I6AQT3_RAT ETS variant transcription factor 5 OS=Rattus norvegicus OX=10116 GN=Etv5 PE=3 SV=1
19	P50549	1.44e-28	119	477	0.123	0.105	ETV1_HUMAN ETS translocation variant 1 OS=Homo sapiens OX=9606 GN=ETV1 PE=1 SV=2
20	P41164	1.46e-28	119	477	0.123	0.105	ETV1_MOUSE ETS translocation variant 1 OS=Mus musculus OX=10090 GN=Etv1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	8.3e-30	114.3	Ets-domain
2	PF00447 HSF_DNA-bind	2.1e+02	13.8	HSF-type DNA-binding
3	PF01818 Translat_reg	2e+02	13.4	Bacteriophage translational regulator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228741

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398089	0.641	Zinc finger protein 821
2	9606.ENSP00000328813	0.580	Potassium voltage-gated channel subfamily H member 8
3	9606.ENSP00000379369	0.530	Forkhead box B1
4	9606.ENSP00000294964	0.523	Extracellular tyrosine-protein kinase PKDCC

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0005515	0.989	protein binding
GO:0000981	0.948	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.858	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.850	DNA-binding transcription activator activity
GO:0001228	0.699	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.995	regulation of gene expression
GO:0019219	0.995	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0009987	0.984	cellular process
GO:0006357	0.982	regulation of transcription by RNA polymerase II
GO:0045893	0.966	positive regulation of DNA-templated transcription
GO:0050896	0.943	response to stimulus
GO:0048519	0.926	negative regulation of biological process
GO:0048523	0.841	negative regulation of cellular process
GO:0045944	0.724	positive regulation of transcription by RNA polymerase II
GO:0051716	0.597	cellular response to stimulus
GO:0009892	0.592	negative regulation of metabolic process
GO:0010605	0.557	negative regulation of macromolecule metabolic process
GO:0045934	0.552	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.547	negative regulation of biosynthetic process
GO:0023052	0.542	signaling
GO:0045892	0.539	negative regulation of DNA-templated transcription
GO:0007154	0.529	cell communication
GO:0006950	0.460	response to stress
GO:0007165	0.458	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.995	cytoplasm
GO:0005739	0.749	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]