StarFunc result for job id P42081

User Input

>input (329 residues)
MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM
IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI
EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ
PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK
IHIPERSDEAQRVFKSSKTSSCDKSDTCF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42081	0.999	0.999	1.233E-56	329	1.000	1.000	P42081.pdb.gz	CD86_HUMAN T-lymphocyte activation antigen CD86 OS=Homo sapiens OX=9606 GN=CD86 PE=1 SV=2
2	AFDB:P42082	0.657	0.696	7.849E-34	309	0.471	0.502	P42082.pdb.gz	CD86_MOUSE T-lymphocyte activation antigen CD86 OS=Mus musculus OX=10090 GN=Cd86 PE=1 SV=1
3	AFDB:O35531	0.648	0.680	4.018E-32	313	0.441	0.463	O35531.pdb.gz	O35531_RAT CD86 molecule OS=Rattus norvegicus OX=10116 GN=Cd86 PE=1 SV=1
4	AFDB:G3V671	0.561	0.574	1.017E-18	321	0.204	0.209	G3V671.pdb.gz	G3V671_RAT Cd80 molecule OS=Rattus norvegicus OX=10116 GN=Cd80 PE=4 SV=2
5	AFDB:Q00609	0.550	0.588	2.211E-18	306	0.222	0.239	Q00609.pdb.gz	CD80_MOUSE T-lymphocyte activation antigen CD80 OS=Mus musculus OX=10090 GN=Cd80 PE=1 SV=1
6	AFDB:P33681	0.491	0.549	5.333E-18	288	0.185	0.212	P33681.pdb.gz	CD80_HUMAN T-lymphocyte activation antigen CD80 OS=Homo sapiens OX=9606 GN=CD80 PE=1 SV=1
7	AFDB:K4DIA0	0.531	0.383	2.050E-17	473	0.219	0.152	K4DIA0.pdb.gz	K4DIA0_HUMAN Inducible T cell costimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=1
8	AFDB:Q8VE98	0.517	0.536	8.297E-17	316	0.207	0.215	Q8VE98.pdb.gz	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
9	AFDB:Q9JHJ8	0.534	0.544	2.219E-16	322	0.201	0.205	Q9JHJ8.pdb.gz	ICOSL_MOUSE ICOS ligand OS=Mus musculus OX=10090 GN=Icoslg PE=1 SV=1
10	AFDB:Q5ZPR3	0.512	0.329	5.636E-16	534	0.201	0.124	Q5ZPR3.pdb.gz	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
11	PDB:3o3uN	0.464	0.280	6.485E-11	580	0.119	0.067	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
12	PDB:1knoE	0.245	0.347	2.033E-8	214	0.128	0.196	1knoE.pdb.gz	Crystal structure of the complex of a catalytic antibody Fab fragment with a transition state analog: structural similarities in esterase-like catalytic antibodies.
13	PDB:4adfM	0.447	0.724	3.077E-8	191	0.088	0.152	4adfM.pdb.gz
14	PDB:1gafL	0.233	0.323	5.164E-8	214	0.128	0.196	1gafL.pdb.gz	The immunological evolution of catalysis.
15	PDB:6dcvA	0.236	0.319	7.045E-8	220	0.134	0.200	6dcvA.pdb.gz
16	PDB:1mh5L	0.222	0.312	8.229E-8	212	0.122	0.189	1mh5L.pdb.gz	High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
17	PDB:4ydvL	0.232	0.336	9.127E-8	206	0.128	0.204	4ydvL.pdb.gz	Human Non-neutralizing HIV-1 Envelope Monoclonal Antibodies Limit the Number of Founder Viruses during SHIV Mucosal Infection in Rhesus Macaques.
18	PDB:1ngwH	0.235	0.333	1.245E-7	216	0.100	0.153	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
19	PDB:5ewiL	0.243	0.342	1.381E-7	217	0.128	0.194	5ewiL.pdb.gz
20	PDB:1fdlL	0.231	0.314	1.613E-7	214	0.140	0.215	1fdlL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7C4F8	0.0	548	277	0.839	0.996	H7C4F8_HUMAN CD86 molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD86 PE=1 SV=1
2	P42081	0.0	685	329	1.000	1.000	CD86_HUMAN T-lymphocyte activation antigen CD86 OS=Homo sapiens OX=9606 GN=CD86 PE=1 SV=2
3	P42082	8.56e-93	280	309	0.426	0.453	CD86_MOUSE T-lymphocyte activation antigen CD86 OS=Mus musculus OX=10090 GN=Cd86 PE=1 SV=1
4	O35531	1.18e-87	267	313	0.432	0.454	O35531_RAT CD86 molecule OS=Rattus norvegicus OX=10116 GN=Cd86 PE=1 SV=1
5	A0A8J8XMF6	1.03e-81	251	297	0.407	0.451	A0A8J8XMF6_RAT CD86 molecule OS=Rattus norvegicus OX=10116 GN=Cd86 PE=1 SV=1
6	Q00609	8.23e-16	79.0	306	0.198	0.212	CD80_MOUSE T-lymphocyte activation antigen CD80 OS=Mus musculus OX=10090 GN=Cd80 PE=1 SV=1
7	G3V671	5.65e-12	67.8	324	0.182	0.185	G3V671_RAT Cd80 molecule OS=Rattus norvegicus OX=10116 GN=Cd80 PE=4 SV=2
8	P33681	5.71e-12	67.4	288	0.210	0.240	CD80_HUMAN T-lymphocyte activation antigen CD80 OS=Homo sapiens OX=9606 GN=CD80 PE=1 SV=1
9	O35187	1.89e-11	66.2	321	0.179	0.184	O35187_RAT B7.1 OS=Rattus norvegicus OX=10116 GN=Cd80 PE=2 SV=1
10	Q62556	4.54e-10	62.8	524	0.234	0.147	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
11	Q5ZPR3	1.40e-09	61.2	534	0.210	0.129	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
12	O00478	5.78e-09	59.7	584	0.234	0.132	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
13	Q13410	3.09e-08	57.0	526	0.201	0.125	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
14	Q8VE98	6.09e-08	55.8	316	0.173	0.180	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
15	P78410	7.45e-08	55.5	334	0.246	0.243	BT3A2_HUMAN Butyrophilin subfamily 3 member A2 OS=Homo sapiens OX=9606 GN=BTN3A2 PE=1 SV=2
16	Q9EP73	9.87e-08	54.7	290	0.213	0.241	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
17	Q9NZQ7	1.12e-07	54.7	290	0.185	0.210	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
18	K4DIA0	1.29e-07	55.1	473	0.152	0.106	K4DIA0_HUMAN Inducible T cell costimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=1
19	Q9JHJ8	2.36e-07	53.9	322	0.179	0.183	ICOSL_MOUSE ICOS ligand OS=Mus musculus OX=10090 GN=Icoslg PE=1 SV=1
20	A0N0L8	3.09e-07	53.5	302	0.152	0.166	A0N0L8_HUMAN Inducible T-cell co-stimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	2.7e+02	13.0	CD80-like C2-set immunoglobulin domain
2	PF14316 DUF4381	4.9e+02	12.4	Domain of unknown function (DUF4381)
3	PF07679 I-set	20	16.7	Immunoglobulin I-set domain
4	PF00047 ig	90	14.7	Immunoglobulin domain
5	PF13895 Ig_2	0.00019	33.0	Immunoglobulin domain
6	PF13927 Ig_3	0.027	26.3	Immunoglobulin domain
7	PF15681 LAX	10	16.5	Lymphocyte activation family X
8	PF07686 V-set	0.00036	32.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332049

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303939	0.999	Cytotoxic T-lymphocyte protein 4
2	9606.ENSP00000324890	0.999	T-cell-specific surface glycoprotein CD28
3	9606.ENSP00000011653	0.995	T-cell surface glycoprotein CD4
4	9606.ENSP00000386559	0.987	T-cell surface glycoprotein CD8 alpha chain
5	9606.ENSP00000412237	0.987	Interleukin-10
6	9606.ENSP00000264246	0.981	T-lymphocyte activation antigen CD80
7	9606.ENSP00000264832	0.980	Intercellular adhesion molecule 1
8	9606.ENSP00000354566	0.961	T-cell surface glycoprotein CD3 epsilon chain
9	9606.ENSP00000327513	0.960	Macrophage colony-stimulating factor 1
10	9606.ENSP00000354782	0.958	T-cell surface glycoprotein CD3 zeta chain
11	9606.ENSP00000353099	0.956	HLA class II histocompatibility antigen, DRB1-15 beta chain
12	9606.ENSP00000378786	0.954	HLA class II histocompatibility antigen, DR alpha chain
13	9606.ENSP00000264972	0.953	Tyrosine-protein kinase ZAP-70
14	9606.ENSP00000361359	0.952	Tumor necrosis factor receptor superfamily member 5
15	9606.ENSP00000379873	0.951	HLA class I histocompatibility antigen, A-3 alpha chain
16	9606.ENSP00000452780	0.950	Beta-2-microglobulin
17	9606.ENSP00000264072	0.948	Low affinity immunoglobulin epsilon Fc receptor
18	9606.ENSP00000337825	0.946	Tyrosine-protein kinase Lck
19	9606.ENSP00000386380	0.944	Interleukin-1 receptor type 1
20	9606.ENSP00000340944	0.940	Tyrosine-protein phosphatase non-receptor type 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0005102	0.401	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0002376	0.994	immune system process
GO:0048522	0.987	positive regulation of cellular process
GO:0006955	0.939	immune response
GO:0042127	0.924	regulation of cell population proliferation
GO:0008284	0.906	positive regulation of cell population proliferation
GO:0009987	0.878	cellular process
GO:0051716	0.787	cellular response to stimulus
GO:0023052	0.702	signaling
GO:0007154	0.702	cell communication
GO:0019222	0.559	regulation of metabolic process
GO:0051239	0.544	regulation of multicellular organismal process
GO:0007165	0.538	signal transduction
GO:0002682	0.534	regulation of immune system process
GO:0060255	0.531	regulation of macromolecule metabolic process
GO:0002684	0.432	positive regulation of immune system process
GO:0002694	0.427	regulation of leukocyte activation
GO:0042221	0.409	response to chemical
GO:0048583	0.407	regulation of response to stimulus
GO:0051240	0.397	positive regulation of multicellular organismal process
GO:0010604	0.397	positive regulation of macromolecule metabolic process
GO:0009605	0.394	response to external stimulus
GO:0048519	0.363	negative regulation of biological process
GO:0010468	0.359	regulation of gene expression
GO:0006950	0.348	response to stress
GO:0051249	0.331	regulation of lymphocyte activation
GO:0030155	0.319	regulation of cell adhesion
GO:0070887	0.318	cellular response to chemical stimulus
GO:0010033	0.303	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043229	0.999	intracellular organelle
GO:0005576	0.977	extracellular region
GO:0043227	0.958	membrane-bounded organelle
GO:0043232	0.938	intracellular non-membrane-bounded organelle
GO:0031982	0.893	vesicle
GO:0005615	0.886	extracellular space
GO:0015630	0.871	microtubule cytoskeleton
GO:0005815	0.846	microtubule organizing center
GO:0034451	0.835	centriolar satellite
GO:0009986	0.816	cell surface
GO:0043230	0.795	extracellular organelle
GO:0070062	0.791	extracellular exosome
GO:0005737	0.746	cytoplasm
GO:0043231	0.673	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]