StarFunc result for job id P42126

User Input

>input (302 residues)
MALVASVRVPARVLLRAGARLPGAALGRTERAAGGGDGARRFGSQRVLVEPDAGAGVAVM
KFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRSPAH
YAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLNETQ
LGIIAPFWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTALSAI
AQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQMYLERLKEE
KG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384NKJ3	0.903	0.903	4.731E-52	302	1.000	1.000	A0A384NKJ3.pdb.gz	A0A384NKJ3_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:P42125	0.870	0.909	3.206E-40	289	0.709	0.740	P42125.pdb.gz	ECI1_MOUSE Enoyl-CoA delta isomerase 1, mitochondrial OS=Mus musculus OX=10090 GN=Eci1 PE=1 SV=2
3	AFDB:P23965	0.872	0.911	9.887E-40	289	0.719	0.751	P23965.pdb.gz	ECI1_RAT Enoyl-CoA delta isomerase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Eci1 PE=1 SV=1
4	PDB:1xx4A	0.823	0.978	2.414E-37	254	0.656	0.780	1xx4A.pdb.gz	Domain swapping in the low-similarity isomerase/hydratase superfamily: the crystal structure of rat mitochondrial Delta3, Delta2-enoyl-CoA isomerase.
5	AFDB:Q9VL68	0.816	0.875	1.284E-25	281	0.351	0.377	Q9VL68.pdb.gz	Q9VL68_DROME RH73277p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4598 PE=1 SV=2
6	AFDB:Q57V74	0.823	0.696	7.534E-25	358	0.344	0.291	Q57V74.pdb.gz	Q57V74_TRYB2 3,2-trans-enoyl-CoA isomerase, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.50 PE=3 SV=1
7	AFDB:Q584L4	0.830	0.629	3.764E-24	400	0.338	0.255	Q584L4.pdb.gz	Q584L4_TRYB2 3,2-trans-enoyl-CoA isomerase, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.150 PE=4 SV=1
8	AFDB:Q580R2	0.799	0.778	4.988E-20	311	0.275	0.267	Q580R2.pdb.gz	Q580R2_TRYB2 3,2-trans-enoyl-CoA isomerase, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.870 PE=4 SV=1
9	AFDB:A1Z934	0.677	0.683	3.879E-15	299	0.248	0.251	A1Z934.pdb.gz	A1Z934_DROME SD19268p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8778 PE=1 SV=1
10	AFDB:Q64428	0.655	0.274	5.646E-15	763	0.205	0.081	Q64428.pdb.gz	ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hadha PE=1 SV=2
11	AFDB:Q7JR58	0.636	0.650	6.285E-15	295	0.232	0.237	Q7JR58.pdb.gz	Q7JR58_DROME Enoyl-CoA hydratase, short chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Echs1 PE=1 SV=1
12	PDB:6ysvA	0.701	0.310	8.009E-15	708	0.212	0.090	6ysvA.pdb.gz
13	PDB:5zaiC	0.654	0.757	3.407E-14	259	0.189	0.220	5zaiC.pdb.gz	Structural Insight into Substrate Specificity of 3-Hydroxypropionyl-Coenzyme A Dehydratase from Metallosphaera sedula
14	PDB:4fzwB	0.648	0.757	1.109E-13	256	0.209	0.246	4fzwB.pdb.gz
15	PDB:6tnmA	0.699	0.306	1.302E-13	719	0.212	0.089	6tnmA.pdb.gz	Insights into the stability and substrate specificity of the E. coli aerobic beta-oxidation trifunctional enzyme complex.
16	PDB:1dubA	0.647	0.745	1.374E-13	260	0.185	0.215	1dubA.pdb.gz	Crystal structure of enoyl-coenzyme A (CoA) hydratase at 2.5 angstroms resolution: a spiral fold defines the CoA-binding pocket.
17	PDB:3h81A	0.630	0.736	3.806E-13	256	0.199	0.234	3h81A.pdb.gz	Increasing the structural coverage of tuberculosis drug targets.
18	PDB:2hw5C	0.638	0.734	4.976E-13	260	0.175	0.204	2hw5C.pdb.gz	The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1
19	PDB:4hc8A	0.683	0.865	3.619E-12	236	0.179	0.229	4hc8A.pdb.gz
20	PDB:4b3iA	0.666	0.288	8.089E-12	731	0.202	0.083	4b3iA.pdb.gz	Structure of Mycobacterial Beta-Oxidation Trifunctional Enzyme Reveals its Altered Assembly and Putative Substrate Channeling Pathway.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384NKJ3	0.0	616	302	1.000	1.000	A0A384NKJ3_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	P42126	0.0	616	302	1.000	1.000	ECI1_HUMAN Enoyl-CoA delta isomerase 1, mitochondrial OS=Homo sapiens OX=9606 GN=ECI1 PE=1 SV=1
3	Q96DC0	0.0	505	243	0.805	1.000	Q96DC0_HUMAN DCI protein OS=Homo sapiens OX=9606 GN=ECI1 PE=1 SV=1
4	H3BS70	4.75e-168	466	224	0.742	1.000	H3BS70_HUMAN Enoyl-CoA delta isomerase 1 (Fragment) OS=Homo sapiens OX=9606 GN=ECI1 PE=1 SV=1
5	P23965	2.74e-163	457	289	0.735	0.768	ECI1_RAT Enoyl-CoA delta isomerase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Eci1 PE=1 SV=1
6	P42125	5.41e-154	434	289	0.679	0.709	ECI1_MOUSE Enoyl-CoA delta isomerase 1, mitochondrial OS=Mus musculus OX=10090 GN=Eci1 PE=1 SV=2
7	Q9VL68	2.66e-61	197	281	0.351	0.377	Q9VL68_DROME RH73277p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4598 PE=1 SV=2
8	Q584L4	3.65e-51	175	400	0.328	0.247	Q584L4_TRYB2 3,2-trans-enoyl-CoA isomerase, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.150 PE=4 SV=1
9	Q57V74	9.67e-51	173	358	0.325	0.274	Q57V74_TRYB2 3,2-trans-enoyl-CoA isomerase, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.50 PE=3 SV=1
10	Q580R2	4.41e-34	128	311	0.265	0.257	Q580R2_TRYB2 3,2-trans-enoyl-CoA isomerase, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.870 PE=4 SV=1
11	A1Z934	4.48e-18	84.7	299	0.222	0.224	A1Z934_DROME SD19268p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8778 PE=1 SV=1
12	P77399	1.06e-17	85.5	714	0.179	0.076	FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=fadJ PE=1 SV=1
13	Q9LCU3	4.73e-17	81.6	276	0.235	0.257	CBAD2_ARTSP 4-chlorobenzoyl coenzyme A dehalogenase-2 OS=Arthrobacter sp. OX=1667 GN=fcbB2 PE=1 SV=1
14	Q64428	5.20e-15	77.4	763	0.205	0.081	ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hadha PE=1 SV=2
15	Q8BMS1	6.19e-14	74.3	763	0.166	0.066	ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Hadha PE=1 SV=1
16	A7YT47	7.23e-14	74.3	761	0.172	0.068	A7YT47_DANRE enoyl-CoA hydratase OS=Danio rerio OX=7955 GN=hadha PE=1 SV=1
17	F4JML5	1.47e-13	72.0	301	0.172	0.173	ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
18	Q39659	1.96e-13	72.8	725	0.202	0.084	MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus OX=3659 PE=1 SV=1
19	P76082	2.14e-13	70.9	255	0.205	0.243	PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) OX=83333 GN=paaF PE=1 SV=1
20	E9KL44	2.29e-13	72.8	763	0.169	0.067	E9KL44_HUMAN enoyl-CoA hydratase OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00378 ECH_1	2.5e-88	307.2	Enoyl-CoA hydratase/isomerase
2	PF16113 ECH_2	5.7e-09	47.6	Enoyl-CoA hydratase/isomerase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301729

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369461	0.995	Enoyl-CoA delta isomerase 2, mitochondrial
2	9606.ENSP00000357535	0.975	Enoyl-CoA hydratase, mitochondrial
3	9606.ENSP00000220764	0.903	2,4-dienoyl-CoA reductase, mitochondrial
4	9606.ENSP00000231887	0.869	Peroxisomal bifunctional enzyme
5	9606.ENSP00000242592	0.842	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
6	9606.ENSP00000474560	0.834	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
7	9606.ENSP00000359871	0.801	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
8	9606.ENSP00000285093	0.793	3-ketoacyl-CoA thiolase, mitochondrial
9	9606.ENSP00000438689	0.780	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
10	9606.ENSP00000346173	0.779	Electron transfer flavoprotein subunit beta
11	9606.ENSP00000323811	0.774	2-hydroxyacyl-CoA lyase 1
12	9606.ENSP00000325136	0.773	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
13	9606.ENSP00000233710	0.771	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
14	9606.ENSP00000219481	0.770	Peroxisomal 2,4-dienoyl-CoA reductase
15	9606.ENSP00000360541	0.754	Carnitine O-palmitoyltransferase 2, mitochondrial
16	9606.ENSP00000221418	0.744	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
17	9606.ENSP00000295030	0.726	Peroxisomal membrane protein PEX13
18	9606.ENSP00000292330	0.723	Protein phosphatase 1 regulatory subunit 35
19	9606.ENSP00000426638	0.701	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
20	9606.ENSP00000396976	0.699	Bromo adjacent homology domain-containing 1 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016863	1.000	intramolecular oxidoreductase activity, transposing C=C bonds
GO:0005488	0.995	binding
GO:0005515	0.988	protein binding
GO:0016829	0.503	lyase activity
GO:0004165	0.492	delta(3)-delta(2)-enoyl-CoA isomerase activity
GO:0042802	0.406	identical protein binding
GO:0016836	0.374	hydro-lyase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0019395	0.993	fatty acid oxidation
GO:0006635	0.984	fatty acid beta-oxidation
GO:0006807	0.320	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.983	intracellular organelle lumen
GO:0016020	0.855	membrane
GO:0005759	0.697	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.3.3.-	1.000	Transposing C=C bonds.
EC:4.-.-.-	0.503	Lyases.
RHEA:45900	0.492	a (3Z)-enoyl-CoA = a 4-saturated (2E)-enoyl-CoA
EC:5.3.3.8	0.492	Delta(3)-Delta(2)-enoyl-CoA isomerase.
EC:4.2.1.-	0.374	Hydro-lyases.

[back to server]