StarFunc result for job id P42224

User Input

>input (750 residues)
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A669KB53	0.985	0.934	0.000	791	0.995	0.943	A0A669KB53.pdb.gz	A0A669KB53_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
2	PDB:1yvlB	0.810	0.923	3.442E-91	653	0.859	0.986	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
3	AFDB:B5X3E8	0.931	0.907	8.601E-90	770	0.683	0.665	B5X3E8.pdb.gz	B5X3E8_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT1 PE=2 SV=1
4	AFDB:A0A0G2JX93	0.416	0.303	7.789E-81	1083	0.855	0.592	A0A0G2JX93.pdb.gz	A0A0G2JX93_RAT Signal transducer and activator of transcription 1 OS=Rattus norvegicus OX=10116 GN=Stat1 PE=1 SV=2
5	AFDB:B0S789	0.877	0.906	4.263E-79	725	0.559	0.578	B0S789.pdb.gz	B0S789_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=STAT PE=3 SV=1
6	AFDB:P40763	0.912	0.889	1.670E-78	770	0.521	0.508	P40763.pdb.gz	STAT3_HUMAN Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=2
7	AFDB:C0SPC7	0.906	0.845	4.510E-77	806	0.508	0.473	C0SPC7.pdb.gz
8	AFDB:O13133	0.907	0.887	2.829E-76	767	0.503	0.492	O13133.pdb.gz	O13133_ONCMY Signal transducer and activator of transcription OS=Oncorhynchus mykiss OX=8022 GN=rbtStat3 PE=2 SV=1
9	AFDB:P42228	0.777	0.778	7.677E-74	749	0.527	0.527	P42228.pdb.gz	STAT4_MOUSE Signal transducer and activator of transcription 4 OS=Mus musculus OX=10090 GN=Stat4 PE=1 SV=1
10	AFDB:A0A2R8Q947	0.784	0.793	1.878E-73	741	0.524	0.530	A0A2R8Q947.pdb.gz
11	AFDB:Q8JFS5	0.782	0.513	1.669E-68	1153	0.513	0.334	Q8JFS5.pdb.gz
12	PDB:6wczA	0.429	0.888	1.351E-19	350	0.200	0.429	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
13	PDB:3oaiA	0.099	0.144	6.568E-3	488	0.020	0.031	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
14	PDB:7tysA	0.092	0.159	2.573E-2	361	0.041	0.086	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
15	PDB:7mjpA	0.096	0.174	2.697E-2	366	0.032	0.066	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
16	PDB:5hzvA	0.104	0.126	3.750E-2	598	0.023	0.028	5hzvA.pdb.gz	Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1.
17	PDB:4lmhD	0.092	0.098	4.120E-2	695	0.056	0.060	4lmhD.pdb.gz	Insights into electron transfer at the microbe-mineral interface: the X-ray crystal structures of Shewanella oneidensis MtrC and OmcA
18	PDB:6wvdA	0.101	0.161	6.005E-2	397	0.047	0.088	6wvdA.pdb.gz
19	PDB:5ghuA	0.108	0.331	7.250E-2	201	0.025	0.095	5ghuA.pdb.gz
20	PDB:2ag2A	0.082	0.249	1.108E-1	164	0.032	0.146	2ag2A.pdb.gz	Crystal Structure Analysis of Phosphatidylcholine-GM2-Activator Product Complexes: Evidence for Hydrolase Activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0D9RIE1	1541	750	0.993	0.993	A0A0D9RIE1_CHLSB Signal transducer and activator of transcription OS=Chlorocebus sabaeus OX=60711 GN=STAT1 PE=3 SV=1
2	A0A0G2JX93	1282	1205	0.856	0.533	A0A0G2JX93_RAT Signal transducer and activator of transcription 1 OS=Rattus norvegicus OX=10116 GN=Stat1 PE=1 SV=2
3	A0A0G2JXH1	746	704	0.524	0.558	A0A0G2JXH1_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat4 PE=1 SV=1
4	A0A0R4IGF2	776	738	0.509	0.518	A0A0R4IGF2_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=z-Stat3 PE=1 SV=2
5	A0A669KB53	1548	791	0.996	0.944	A0A669KB53_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
6	A0A669KB56	1544	748	0.995	0.997	A0A669KB56_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
7	A0A669KB68	1543	748	0.997	1.000	A0A669KB68_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
8	A0A669KBA4	1545	779	0.995	0.958	A0A669KBA4_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
9	A7LH49	1029	739	0.680	0.690	A7LH49_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=LOC100136558 PE=2 SV=1
10	B0JYL6	1483	747	0.960	0.964	B0JYL6_BOVIN Signal transducer and activator of transcription OS=Bos taurus OX=9913 GN=STAT1 PE=1 SV=1
11	B0S789	857	725	0.565	0.585	B0S789_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=STAT PE=3 SV=1
12	B0S790	736	731	0.529	0.543	B0S790_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=STAT PE=3 SV=1
13	B5X3E8	1042	770	0.685	0.668	B5X3E8_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT1 PE=2 SV=1
14	B9UYM8	592	802	0.439	0.410	B9UYM8_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT2 PE=2 SV=1
15	C7EY83	1041	757	0.685	0.679	C7EY83_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT1a PE=2 SV=1
16	F1M9D6	1443	755	0.936	0.930	F1M9D6_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat1 PE=1 SV=3
17	F7FAC1	756	749	0.533	0.534	F7FAC1_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat4 PE=1 SV=1
18	G8JLH9	669	672	0.447	0.499	G8JLH9_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=1
19	J3KPM9	1473	714	0.949	0.997	J3KPM9_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
20	O13133	766	767	0.509	0.498	O13133_ONCMY Signal transducer and activator of transcription OS=Oncorhynchus mykiss OX=8022 GN=rbtStat3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17324 BLI1	5.8e+02	12.6	BLOC-1 interactor 1
2	PF00017 SH2	1.1e-06	39.9	SH2 domain
3	PF12162 STAT1_TAZ2bind	1.6e-08	45.3	STAT1 TAZ2 binding domain
4	PF01017 STAT_alpha	5.3e-51	184.4	STAT protein, all-alpha domain
5	PF02864 STAT_bind	3e-38	142.9	STAT protein, DNA binding domain
6	PF02865 STAT_int	9.8e-39	143.9	STAT protein, protein interaction domain
7	PF16519 TRPM_tetra	2.4e+02	13.2	Tetramerisation domain of TRPM

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000014555

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000007974	0.997	CREB binding protein
2	9601.ENSPPYP00000021551	0.996	Non-receptor tyrosine kinase involved in various processes such as cell growth, development, differentiation or histone modifications. Mediates essential signaling events in both innate and adaptive immunity. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors such as growth hormone (GHR), prolactin (PRLR), leptin (LEPR), erythropoietin (EPOR), thrombopoietin (THPO)
3	9601.ENSPPYP00000006466	0.995	Interferon regulatory factor 9
4	9601.ENSPPYP00000007471	0.995	Protein inhibitor of activated STAT, 1
5	9601.ENSPPYP00000019082	0.995	Uncharacterized protein
6	9601.ENSPPYP00000001481	0.989	Janus kinase 1
7	9601.ENSPPYP00000013236	0.988	E1A binding protein p300
8	9601.ENSPPYP00000009437	0.986	Signal transducer and activator of transcription 3
9	9601.ENSPPYP00000017628	0.986	Interferon regulatory factor 1
10	9601.ENSPPYP00000009756	0.978	Suppressor of cytokine signaling 3
11	9601.ENSPPYP00000010078	0.974	Protein tyrosine phosphatase, non-receptor type 2
12	9601.ENSPPYP00000008184	0.967	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
13	9601.ENSPPYP00000010535	0.967	Protein inhibitor of activated STAT, 4
14	9601.ENSPPYP00000015429	0.963	Protein kinase C delta type
15	9601.ENSPPYP00000009439	0.957	Signal transducer and activator of transcription 5A
16	9601.ENSPPYP00000019671	0.957	Receptor protein-tyrosine kinase
17	9601.ENSPPYP00000009440	0.951	Signal transducer and activator of transcription 5B
18	9601.ENSPPYP00000024122	0.951	Uncharacterized protein
19	9601.ENSPPYP00000003337	0.950	Interferon regulatory factor 7
20	9601.ENSPPYP00000012695	0.945	Interferon (alpha, beta and omega) receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0019899	1.000	enzyme binding
GO:0043565	0.999	sequence-specific DNA binding
GO:0005102	0.998	signaling receptor binding
GO:0005126	0.958	cytokine receptor binding
GO:0042802	0.918	identical protein binding
GO:0140297	0.917	DNA-binding transcription factor binding
GO:0061629	0.896	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003690	0.851	double-stranded DNA binding
GO:1990837	0.841	sequence-specific double-stranded DNA binding
GO:0000977	0.796	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.794	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.761	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.739	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0046983	0.373	protein dimerization activity
GO:0019903	0.330	protein phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007259	0.987	receptor signaling pathway via JAK-STAT
GO:0042221	0.977	response to chemical
GO:0048522	0.977	positive regulation of cellular process
GO:0006950	0.938	response to stress
GO:0010033	0.935	response to organic substance
GO:0060255	0.928	regulation of macromolecule metabolic process
GO:0034097	0.927	response to cytokine
GO:0010556	0.923	regulation of macromolecule biosynthetic process
GO:0042127	0.910	regulation of cell population proliferation
GO:0032501	0.908	multicellular organismal process
GO:0010604	0.904	positive regulation of macromolecule metabolic process
GO:0070887	0.895	cellular response to chemical stimulus
GO:0009605	0.890	response to external stimulus
GO:0071310	0.879	cellular response to organic substance
GO:0008284	0.864	positive regulation of cell population proliferation
GO:0080090	0.803	regulation of primary metabolic process
GO:0032502	0.800	developmental process
GO:0010468	0.782	regulation of gene expression
GO:1901699	0.780	cellular response to nitrogen compound
GO:0043434	0.770	response to peptide hormone
GO:0051171	0.757	regulation of nitrogen compound metabolic process
GO:0031323	0.754	regulation of cellular metabolic process
GO:0048519	0.744	negative regulation of biological process
GO:0051239	0.726	regulation of multicellular organismal process
GO:0010557	0.700	positive regulation of macromolecule biosynthetic process
GO:0050793	0.657	regulation of developmental process
GO:0051094	0.604	positive regulation of developmental process
GO:0048523	0.554	negative regulation of cellular process
GO:0031326	0.549	regulation of cellular biosynthetic process
GO:0051252	0.546	regulation of RNA metabolic process
GO:0048856	0.543	anatomical structure development
GO:0006355	0.540	regulation of DNA-templated transcription
GO:0031325	0.473	positive regulation of cellular metabolic process
GO:0051173	0.470	positive regulation of nitrogen compound metabolic process
GO:0051240	0.452	positive regulation of multicellular organismal process
GO:0002682	0.432	regulation of immune system process
GO:1901653	0.427	cellular response to peptide
GO:0048583	0.425	regulation of response to stimulus
GO:0071375	0.416	cellular response to peptide hormone stimulus
GO:0002376	0.407	immune system process
GO:0008152	0.405	metabolic process
GO:0071345	0.378	cellular response to cytokine stimulus
GO:0006955	0.376	immune response
GO:0071704	0.374	organic substance metabolic process
GO:0044419	0.351	biological process involved in interspecies interaction between organisms
GO:0009607	0.345	response to biotic stimulus
GO:0044238	0.330	primary metabolic process
GO:0051707	0.329	response to other organism
GO:0045595	0.325	regulation of cell differentiation
GO:0006952	0.318	defense response
GO:0065009	0.316	regulation of molecular function
GO:0045935	0.314	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.312	positive regulation of cellular biosynthetic process
GO:0044237	0.307	cellular metabolic process
GO:0001817	0.300	regulation of cytokine production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0031981	0.996	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0043232	0.967	intracellular non-membrane-bounded organelle
GO:0005730	0.879	nucleolus
GO:0016020	0.683	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]