StarFunc result for job id P42226

User Input

>input (847 residues)
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDT
VQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALA
MLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
LQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQE
PHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAF
PQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMD
LRANPSW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H0YJH6	0.864	0.846	0.000	865	0.999	0.978	H0YJH6.pdb.gz	H0YJH6_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT6 PE=1 SV=2
2	AFDB:Q1KQ07	0.782	0.788	0.000	841	0.858	0.864	Q1KQ07.pdb.gz	Q1KQ07_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat6 PE=2 SV=1
3	AFDB:Q8AW24	0.460	0.585	4.032E-35	657	0.209	0.269	Q8AW24.pdb.gz
4	PDB:1yvlB	0.494	0.630	2.010E-32	653	0.205	0.266	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
5	PDB:6wczA	0.279	0.627	8.677E-9	350	0.093	0.226	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
6	PDB:7mjpA	0.091	0.175	1.101E-2	366	0.044	0.101	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
7	AFDB:A0A0U1ZFN5	0.129	0.129	1.570E-2	846	0.100	0.100	A0A0U1ZFN5.pdb.gz	A0A0U1ZFN5_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
8	PDB:4fl2A	0.056	0.080	2.093E-2	555	0.034	0.052	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
9	PDB:7tysA	0.092	0.174	2.516E-2	361	0.040	0.094	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
10	PDB:2zxcA	0.098	0.124	3.633E-2	643	0.028	0.037	2zxcA.pdb.gz	Mechanistic insights into the hydrolysis and synthesis of ceramide by neutral ceramidase.
11	PDB:5yqgC	0.086	0.186	9.529E-2	237	0.031	0.110	5yqgC.pdb.gz	Structural determinants controlling 14-3-3 recruitment to the endocytic adaptor Numb and dissociation of the Numb/alpha-adaptin complex.
12	PDB:7r5jK0	0.056	0.048	1.199E-1	1086	0.045	0.035	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	PDB:6gn0A	0.082	0.208	1.314E-1	239	0.033	0.117	6gn0A.pdb.gz
14	PDB:6xreM	0.086	0.178	1.376E-1	314	0.017	0.045	6xreM.pdb.gz	Structure of the p53/RNA polymerase II assembly.
15	AFDB:P22682	0.127	0.120	1.963E-1	913	0.093	0.087	P22682.pdb.gz	CBL_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cbl PE=1 SV=3
16	AFDB:A1Z7T0	0.107	0.084	3.735E-1	1190	0.140	0.100	A1Z7T0.pdb.gz	PKN_DROME Serine/threonine-protein kinase N OS=Drosophila melanogaster OX=7227 GN=Pkn PE=1 SV=1
17	AFDB:Q13191	0.125	0.112	4.286E-1	982	0.092	0.079	Q13191.pdb.gz	CBLB_HUMAN E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB PE=1 SV=2
18	AFDB:A0A0B4K7Q6	0.070	0.043	4.488E-1	2008	0.120	0.051	A0A0B4K7Q6.pdb.gz	A0A0B4K7Q6_DROME Myoblast city, isoform B OS=Drosophila melanogaster OX=7227 GN=mbc PE=3 SV=1
19	AFDB:A0A0G2JTY4	0.131	0.108	4.699E-1	1076	0.099	0.078	A0A0G2JTY4.pdb.gz	A0A0G2JTY4_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
20	AFDB:F4JYG0	0.066	0.070	5.393E-1	760	0.117	0.130	F4JYG0.pdb.gz	PIAL2_ARATH E4 SUMO-protein ligase PIAL2 OS=Arabidopsis thaliana OX=3702 GN=PIAL2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K2M3	0.0	1449	852	0.854	0.849	A0A0G2K2M3_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat6 PE=1 SV=1
2	E1U8C5	0.0	1590	848	0.932	0.930	E1U8C5_PIG Signal transducer and activator of transcription OS=Sus scrofa OX=9823 GN=stat6 PE=2 SV=1
3	E5F1H4	0.0	1594	847	0.932	0.932	E5F1H4_PIG Signal transducer and activator of transcription OS=Sus scrofa OX=9823 GN=STAT6 PE=2 SV=1
4	H0YJH6	0.0	1723	865	1.000	0.979	H0YJH6_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT6 PE=1 SV=2
5	P42226	0.0	1734	847	1.000	1.000	STAT6_HUMAN Signal transducer and activator of transcription 6 OS=Homo sapiens OX=9606 GN=STAT6 PE=1 SV=1
6	P52633	0.0	1472	837	0.856	0.866	STAT6_MOUSE Signal transducer and transcription activator 6 OS=Mus musculus OX=10090 GN=Stat6 PE=1 SV=2
7	Q1KQ07	0.0	1459	841	0.854	0.860	Q1KQ07_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat6 PE=2 SV=1
8	P42230	9.68e-153	469	793	0.351	0.375	STA5A_MOUSE Signal transducer and activator of transcription 5A OS=Mus musculus OX=10090 GN=Stat5a PE=1 SV=1
9	Q9JIA0	9.68e-153	469	793	0.351	0.375	Q9JIA0_MOUSE Signal transducer and activator of transcription OS=Mus musculus OX=10090 GN=Stat5a PE=1 SV=2
10	P51692	1.84e-152	468	787	0.360	0.388	STA5B_HUMAN Signal transducer and activator of transcription 5B OS=Homo sapiens OX=9606 GN=STAT5B PE=1 SV=2
11	B3DGV1	3.05e-152	466	758	0.339	0.379	B3DGV1_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=sb:eu508 PE=1 SV=1
12	P42232	4.02e-152	467	786	0.360	0.388	STA5B_MOUSE Signal transducer and activator of transcription 5B OS=Mus musculus OX=10090 GN=Stat5b PE=1 SV=1
13	Q68SP3	7.41e-152	466	785	0.338	0.364	Q68SP3_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=stat5.1 PE=1 SV=1
14	A0A384N5W4	7.74e-152	467	794	0.354	0.378	A0A384N5W4_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT5A PE=2 SV=1
15	P42229	7.74e-152	467	794	0.354	0.378	STA5A_HUMAN Signal transducer and activator of transcription 5A OS=Homo sapiens OX=9606 GN=STAT5A PE=1 SV=1
16	Q9DG74	1.96e-151	465	784	0.355	0.384	Q9DG74_ONCMY Signal transducer and activator of transcription OS=Oncorhynchus mykiss OX=8022 GN=STAT5 PE=2 SV=1
17	Q62771	4.72e-151	464	793	0.353	0.377	STA5A_RAT Signal transducer and activator of transcription 5A OS=Rattus norvegicus OX=10116 GN=Stat5a PE=1 SV=1
18	P52632	4.85e-150	462	786	0.336	0.363	STA5B_RAT Signal transducer and activator of transcription 5B OS=Rattus norvegicus OX=10116 GN=Stat5b PE=1 SV=1
19	W5UJB3	4.64e-148	456	773	0.340	0.373	W5UJB3_ICTPU Signal transducer and activator of transcription OS=Ictalurus punctatus OX=7998 GN=STAT6 PE=2 SV=1
20	K7EIF9	3.83e-142	437	658	0.311	0.400	K7EIF9_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT5A PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00017 SH2	2.4e-07	42.1	SH2 domain
2	PF14596 STAT6_C	3.2e-107	368.3	STAT6 C-terminal
3	PF01017 STAT_alpha	1.6e-08	46.2	STAT protein, all-alpha domain
4	PF02864 STAT_bind	2.8e-32	123.5	STAT protein, DNA binding domain
5	PF02865 STAT_int	1.5e-18	78.7	STAT protein, protein interaction domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300134

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379111	0.997	Interleukin-4 receptor subunit alpha
2	9606.ENSP00000385216	0.997	Nuclear receptor coactivator 1
3	9606.ENSP00000262367	0.996	CREB-binding protein
4	9606.ENSP00000263253	0.994	Histone acetyltransferase p300
5	9606.ENSP00000231449	0.991	Interleukin-4
6	9606.ENSP00000343204	0.991	Tyrosine-protein kinase JAK1
7	9606.ENSP00000371067	0.985	Tyrosine-protein kinase JAK2
8	9606.ENSP00000391676	0.985	Tyrosine-protein kinase JAK3
9	9606.ENSP00000368632	0.981	Trans-acting T-cell-specific transcription factor GATA-3
10	9606.ENSP00000418194	0.977	Poly [ADP-ribose] polymerase 14
11	9606.ENSP00000431885	0.974	Non-receptor tyrosine-protein kinase TYK2
12	9606.ENSP00000287820	0.973	Peroxisome proliferator-activated receptor gamma
13	9606.ENSP00000329418	0.970	Suppressor of cytokine signaling 1
14	9606.ENSP00000360730	0.963	Interleukin-13 receptor subunit alpha-1
15	9606.ENSP00000302234	0.959	Eotaxin
16	9606.ENSP00000376436	0.957	Protein C-ets-1
17	9606.ENSP00000363318	0.955	Cytokine receptor common subunit gamma
18	9606.ENSP00000264072	0.949	Low affinity immunoglobulin epsilon Fc receptor
19	9606.ENSP00000311857	0.949	Tyrosine-protein phosphatase non-receptor type 2
20	9606.ENSP00000391592	0.948	Tyrosine-protein phosphatase non-receptor type 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:0005515	0.992	protein binding
GO:0019899	0.800	enzyme binding
GO:0008134	0.478	transcription factor binding
GO:0042802	0.461	identical protein binding
GO:0005102	0.453	signaling receptor binding
GO:0003690	0.453	double-stranded DNA binding
GO:1990837	0.377	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0023052	0.996	signaling
GO:0051716	0.996	cellular response to stimulus
GO:0048518	0.984	positive regulation of biological process
GO:0019222	0.980	regulation of metabolic process
GO:0007165	0.979	signal transduction
GO:0042221	0.969	response to chemical
GO:0048522	0.969	positive regulation of cellular process
GO:0060255	0.960	regulation of macromolecule metabolic process
GO:0010604	0.944	positive regulation of macromolecule metabolic process
GO:0080090	0.940	regulation of primary metabolic process
GO:0071345	0.940	cellular response to cytokine stimulus
GO:0051171	0.939	regulation of nitrogen compound metabolic process
GO:0031323	0.939	regulation of cellular metabolic process
GO:0007166	0.937	cell surface receptor signaling pathway
GO:0019221	0.926	cytokine-mediated signaling pathway
GO:0010468	0.908	regulation of gene expression
GO:0031325	0.906	positive regulation of cellular metabolic process
GO:0031326	0.904	regulation of cellular biosynthetic process
GO:0051173	0.902	positive regulation of nitrogen compound metabolic process
GO:0006355	0.885	regulation of DNA-templated transcription
GO:0010557	0.852	positive regulation of macromolecule biosynthetic process
GO:0006357	0.844	regulation of transcription by RNA polymerase II
GO:0045893	0.836	positive regulation of DNA-templated transcription
GO:0048519	0.814	negative regulation of biological process
GO:0048523	0.671	negative regulation of cellular process
GO:0045944	0.669	positive regulation of transcription by RNA polymerase II
GO:0006950	0.541	response to stress
GO:0048583	0.388	regulation of response to stimulus
GO:0051239	0.352	regulation of multicellular organismal process
GO:0071704	0.305	organic substance metabolic process
GO:0002376	0.301	immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm
GO:0005829	0.991	cytosol
GO:0032991	0.990	protein-containing complex
GO:0016020	0.879	membrane
GO:0071944	0.672	cell periphery
GO:0005886	0.579	plasma membrane
GO:0043232	0.382	intracellular non-membrane-bounded organelle
GO:0012505	0.317	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]