StarFunc result for job id P42229

User Input

>input (794 residues)
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLV
REANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATY
MDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLS
PPAGLFTSARGSLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384N5W4	0.759	0.759	0.000	794	1.000	1.000	A0A384N5W4.pdb.gz	A0A384N5W4_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT5A PE=2 SV=1
2	AFDB:K7EK35	0.718	0.746	9.915E-101	763	0.958	0.997	K7EK35.pdb.gz	K7EK35_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT5A PE=1 SV=1
3	AFDB:C0SPC8	0.776	0.785	7.306E-95	785	0.771	0.780	C0SPC8.pdb.gz
4	AFDB:A0A286Y960	0.621	0.649	1.332E-54	758	0.349	0.365	A0A286Y960.pdb.gz
5	AFDB:W5UJB3	0.628	0.645	1.176E-53	773	0.348	0.357	W5UJB3.pdb.gz	W5UJB3_ICTPU Signal transducer and activator of transcription OS=Ictalurus punctatus OX=7998 GN=STAT6 PE=2 SV=1
6	AFDB:Q1KQ07	0.631	0.597	6.364E-53	841	0.368	0.347	Q1KQ07.pdb.gz	Q1KQ07_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat6 PE=2 SV=1
7	AFDB:H0YJH6	0.579	0.532	2.227E-51	865	0.374	0.343	H0YJH6.pdb.gz	H0YJH6_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT6 PE=1 SV=2
8	AFDB:Q24151	0.616	0.641	1.448E-44	761	0.302	0.315	Q24151.pdb.gz	STAT_DROME Signal transducer and transcription activator OS=Drosophila melanogaster OX=7227 GN=Stat92E PE=1 SV=1
9	AFDB:P40763	0.630	0.648	1.233E-42	770	0.286	0.295	P40763.pdb.gz	STAT3_HUMAN Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=2
10	AFDB:C0SPC7	0.616	0.608	3.277E-42	806	0.310	0.305	C0SPC7.pdb.gz
11	PDB:1yvlB	0.571	0.685	5.222E-38	653	0.262	0.319	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
12	PDB:6wczA	0.363	0.780	5.240E-11	350	0.117	0.266	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
13	PDB:7tysA	0.097	0.184	4.139E-2	361	0.039	0.086	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
14	PDB:2zxcA	0.105	0.127	7.375E-2	643	0.014	0.017	2zxcA.pdb.gz	Mechanistic insights into the hydrolysis and synthesis of ceramide by neutral ceramidase.
15	PDB:7mjpA	0.087	0.166	7.710E-2	366	0.029	0.063	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
16	PDB:3oaiA	0.086	0.129	1.502E-1	488	0.019	0.031	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
17	PDB:6wvdA	0.088	0.133	1.570E-1	397	0.040	0.081	6wvdA.pdb.gz
18	PDB:1xl6A	0.087	0.176	1.716E-1	291	0.031	0.086	1xl6A.pdb.gz
19	PDB:4wrnB	0.082	0.095	1.716E-1	663	0.021	0.026	4wrnB.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
20	PDB:5fl1A	0.052	0.058	2.448E-1	703	0.033	0.037	5fl1A.pdb.gz	Analysis of transition state mimicry by tight binding aminothiazoline inhibitors provides insight into catalysis by humanO-GlcNAcase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384N5W4	0.0	1647	794	1.000	1.000	A0A384N5W4_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT5A PE=2 SV=1
2	K7EIF9	0.0	1364	658	0.829	1.000	K7EIF9_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT5A PE=1 SV=3
3	K7EK35	0.0	1566	763	0.961	1.000	K7EK35_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT5A PE=1 SV=1
4	P42229	0.0	1647	794	1.000	1.000	STA5A_HUMAN Signal transducer and activator of transcription 5A OS=Homo sapiens OX=9606 GN=STAT5A PE=1 SV=1
5	P42230	0.0	1592	793	0.963	0.965	STA5A_MOUSE Signal transducer and activator of transcription 5A OS=Mus musculus OX=10090 GN=Stat5a PE=1 SV=1
6	P42232	0.0	1481	786	0.904	0.913	STA5B_MOUSE Signal transducer and activator of transcription 5B OS=Mus musculus OX=10090 GN=Stat5b PE=1 SV=1
7	P51692	0.0	1506	787	0.921	0.929	STA5B_HUMAN Signal transducer and activator of transcription 5B OS=Homo sapiens OX=9606 GN=STAT5B PE=1 SV=2
8	P52632	0.0	1479	786	0.903	0.912	STA5B_RAT Signal transducer and activator of transcription 5B OS=Rattus norvegicus OX=10116 GN=Stat5b PE=1 SV=1
9	Q62771	0.0	1582	793	0.958	0.960	STA5A_RAT Signal transducer and activator of transcription 5A OS=Rattus norvegicus OX=10116 GN=Stat5a PE=1 SV=1
10	Q68SP3	0.0	1264	785	0.776	0.785	Q68SP3_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=stat5.1 PE=1 SV=1
11	Q9DG74	0.0	1262	784	0.771	0.781	Q9DG74_ONCMY Signal transducer and activator of transcription OS=Oncorhynchus mykiss OX=8022 GN=STAT5 PE=2 SV=1
12	Q9JIA0	0.0	1592	793	0.963	0.965	Q9JIA0_MOUSE Signal transducer and activator of transcription OS=Mus musculus OX=10090 GN=Stat5a PE=1 SV=2
13	Q9R0X9	1.27e-162	472	230	0.288	0.996	Q9R0X9_MOUSE Mammary gland factor STAT5A (Fragment) OS=Mus musculus OX=10090 GN=STAT5A PE=4 SV=1
14	P52633	4.16e-156	477	837	0.374	0.355	STAT6_MOUSE Signal transducer and transcription activator 6 OS=Mus musculus OX=10090 GN=Stat6 PE=1 SV=2
15	E5F1H4	4.66e-155	475	847	0.390	0.366	E5F1H4_PIG Signal transducer and activator of transcription OS=Sus scrofa OX=9823 GN=STAT6 PE=2 SV=1
16	E1U8C5	1.09e-154	474	848	0.390	0.366	E1U8C5_PIG Signal transducer and activator of transcription OS=Sus scrofa OX=9823 GN=stat6 PE=2 SV=1
17	Q1KQ07	2.30e-154	473	841	0.368	0.347	Q1KQ07_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat6 PE=2 SV=1
18	P42226	1.02e-151	466	847	0.382	0.358	STAT6_HUMAN Signal transducer and activator of transcription 6 OS=Homo sapiens OX=9606 GN=STAT6 PE=1 SV=1
19	A0A0G2K2M3	8.71e-151	464	852	0.372	0.346	A0A0G2K2M3_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat6 PE=1 SV=1
20	B3DGV1	4.07e-148	454	758	0.354	0.371	B3DGV1_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=sb:eu508 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00017 SH2	1.1e-08	46.4	SH2 domain
2	PF01017 STAT_alpha	9.8e-43	157.5	STAT protein, all-alpha domain
3	PF02864 STAT_bind	9.8e-49	176.8	STAT protein, DNA binding domain
4	PF02865 STAT_int	1e-37	140.6	STAT protein, protein interaction domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000015668

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000035490	0.996	Tyrosine-protein kinase
2	9598.ENSPTRP00000001425	0.993	Tyrosine-protein kinase
3	9598.ENSPTRP00000022026	0.990	Receptor protein-tyrosine kinase
4	9598.ENSPTRP00000032807	0.989	Receptor protein-tyrosine kinase
5	9598.ENSPTRP00000003829	0.977	Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells
6	9598.ENSPTRP00000024841	0.972	Pan troglodytes E1A binding protein p300 (EP300), mRNA
7	9598.ENSPTRP00000013169	0.969	Uncharacterized protein
8	9598.ENSPTRP00000040514	0.969	Interleukin 2 receptor, gamma
9	9598.ENSPTRP00000060580	0.963	Cytokine inducible SH2-containing protein
10	9598.ENSPTRP00000040293	0.960	Janus kinase 3
11	9598.ENSPTRP00000049016	0.960	Tyrosine kinase 2
12	9598.ENSPTRP00000021795	0.957	Signal transducer and activator of transcription 1, 91kDa
13	9598.ENSPTRP00000015670	0.953	Signal transducer and activator of transcription
14	9598.ENSPTRP00000049007	0.949	Receptor for erythropoietin
15	9598.ENSPTRP00000055411	0.949	Interferon regulatory factor 9
16	9598.ENSPTRP00000016513	0.948	Suppressor of cytokine signaling 3
17	9598.ENSPTRP00000027637	0.948	Uncharacterized protein
18	9598.ENSPTRP00000009773	0.944	Uncharacterized protein
19	9598.ENSPTRP00000013256	0.942	Suppressor of cytokine signaling 1
20	9598.ENSPTRP00000028855	0.925	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0003677	0.999	DNA binding
GO:0043565	0.943	sequence-specific DNA binding
GO:0019899	0.889	enzyme binding
GO:0042802	0.780	identical protein binding
GO:0005102	0.599	signaling receptor binding
GO:0003690	0.551	double-stranded DNA binding
GO:0008134	0.530	transcription factor binding
GO:1990837	0.412	sequence-specific double-stranded DNA binding
GO:0019901	0.388	protein kinase binding
GO:0061629	0.368	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000976	0.303	transcription cis-regulatory region binding
GO:0000981	0.301	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.990	positive regulation of cellular process
GO:0051239	0.989	regulation of multicellular organismal process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0007259	0.989	receptor signaling pathway via JAK-STAT
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0010468	0.985	regulation of gene expression
GO:0080090	0.982	regulation of primary metabolic process
GO:0031326	0.978	regulation of cellular biosynthetic process
GO:0002682	0.976	regulation of immune system process
GO:0010604	0.975	positive regulation of macromolecule metabolic process
GO:0050793	0.972	regulation of developmental process
GO:0010033	0.967	response to organic substance
GO:0045637	0.963	regulation of myeloid cell differentiation
GO:0045597	0.955	positive regulation of cell differentiation
GO:0001775	0.954	cell activation
GO:0030097	0.947	hemopoiesis
GO:0019219	0.946	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.944	regulation of DNA-templated transcription
GO:0002521	0.920	leukocyte differentiation
GO:0006357	0.919	regulation of transcription by RNA polymerase II
GO:0031325	0.916	positive regulation of cellular metabolic process
GO:0042127	0.915	regulation of cell population proliferation
GO:0051173	0.915	positive regulation of nitrogen compound metabolic process
GO:0046649	0.908	lymphocyte activation
GO:1903131	0.890	mononuclear cell differentiation
GO:0045639	0.889	positive regulation of myeloid cell differentiation
GO:0008284	0.878	positive regulation of cell population proliferation
GO:0030098	0.874	lymphocyte differentiation
GO:0048519	0.872	negative regulation of biological process
GO:0044237	0.866	cellular metabolic process
GO:0010557	0.866	positive regulation of macromolecule biosynthetic process
GO:0071704	0.864	organic substance metabolic process
GO:0006807	0.864	nitrogen compound metabolic process
GO:0019221	0.861	cytokine-mediated signaling pathway
GO:0045944	0.857	positive regulation of transcription by RNA polymerase II
GO:0048583	0.806	regulation of response to stimulus
GO:0002684	0.797	positive regulation of immune system process
GO:0009719	0.791	response to endogenous stimulus
GO:0043170	0.779	macromolecule metabolic process
GO:0044238	0.770	primary metabolic process
GO:0051240	0.770	positive regulation of multicellular organismal process
GO:0043434	0.768	response to peptide hormone
GO:0048523	0.767	negative regulation of cellular process
GO:1901701	0.748	cellular response to oxygen-containing compound
GO:0009058	0.738	biosynthetic process
GO:0007275	0.735	multicellular organism development
GO:0071495	0.715	cellular response to endogenous stimulus
GO:0048513	0.704	animal organ development
GO:0008283	0.696	cell population proliferation
GO:0051179	0.691	localization
GO:0050878	0.687	regulation of body fluid levels
GO:0030099	0.685	myeloid cell differentiation
GO:0042592	0.677	homeostatic process
GO:0048871	0.668	multicellular organismal-level homeostasis
GO:0032870	0.666	cellular response to hormone stimulus
GO:0048731	0.662	system development
GO:0030879	0.653	mammary gland development
GO:0051234	0.651	establishment of localization
GO:0010467	0.643	gene expression
GO:1901699	0.642	cellular response to nitrogen compound
GO:0022414	0.628	reproductive process
GO:0006810	0.594	transport
GO:0048872	0.580	homeostasis of number of cells
GO:0007595	0.570	lactation
GO:0003006	0.534	developmental process involved in reproduction
GO:0006725	0.518	cellular aromatic compound metabolic process
GO:0048584	0.497	positive regulation of response to stimulus
GO:0010628	0.495	positive regulation of gene expression
GO:0002262	0.483	myeloid cell homeostasis
GO:0030218	0.436	erythrocyte differentiation
GO:0006950	0.431	response to stress
GO:0010941	0.312	regulation of cell death
GO:0080134	0.309	regulation of response to stress
GO:0048589	0.303	developmental growth
GO:0009892	0.301	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.998	nucleoplasm
GO:0071944	0.397	cell periphery
GO:0016020	0.359	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]