StarFunc result for job id P42261

User Input

>input (906 residues)
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7ocaA	0.463	0.517	0.000	775	0.839	0.981	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
2	PDB:7rz4A	0.568	0.526	0.000	993	0.637	0.581	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
3	AFDB:A0A0R4ING5	0.667	0.669	0.000	903	0.679	0.681	A0A0R4ING5.pdb.gz
4	AFDB:B3DGZ2	0.668	0.673	0.000	898	0.651	0.657	B3DGZ2.pdb.gz
5	AFDB:P19490	0.847	0.847	0.000	907	0.986	0.985	P19490.pdb.gz	GRIA1_RAT Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2
6	AFDB:P19491	0.669	0.684	0.000	883	0.670	0.687	P19491.pdb.gz	GRIA2_RAT Glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Gria2 PE=1 SV=2
7	AFDB:P19493	0.615	0.617	0.000	902	0.673	0.676	P19493.pdb.gz	GRIA4_RAT Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1
8	AFDB:P42263	0.605	0.612	0.000	894	0.664	0.673	P42263.pdb.gz	GRIA3_HUMAN Glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRIA3 PE=1 SV=2
9	PDB:7rzaA	0.523	0.490	1.855E-103	981	0.636	0.587	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
10	PDB:5kbtA	0.573	0.539	2.062E-103	973	0.623	0.580	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
11	PDB:5weoA	0.578	0.538	3.980E-99	988	0.638	0.585	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
12	PDB:4u1xC	0.504	0.573	1.744E-98	755	0.594	0.713	4u1xC.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
13	PDB:5idfB	0.465	0.560	1.229E-97	734	0.567	0.700	5idfB.pdb.gz
14	PDB:4u1wA	0.505	0.593	1.467E-96	731	0.581	0.720	4u1wA.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
15	PDB:4uq6B	0.400	0.567	5.871E-87	632	0.478	0.685	4uq6B.pdb.gz	Structural Mechanism of Glutamate Receptor Activation and Desensitization
16	AFDB:P39087	0.560	0.559	4.292E-86	908	0.384	0.383	P39087.pdb.gz	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
17	AFDB:B1AS29	0.552	0.546	2.581E-85	919	0.381	0.375	B1AS29.pdb.gz	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
18	AFDB:Q03445	0.489	0.458	8.402E-84	991	0.401	0.366	Q03445.pdb.gz	GLR1_DROME Glutamate receptor 1 OS=Drosophila melanogaster OX=7227 GN=GluRIA PE=1 SV=2
19	AFDB:E7ENK3	0.608	0.586	5.430E-82	949	0.386	0.369	E7ENK3.pdb.gz	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
20	PDB:5kufA	0.510	0.589	3.016E-64	750	0.343	0.415	5kufA.pdb.gz	Structural basis of kainate subtype glutamate receptor desensitization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	B1AS29	624	919	0.379	0.373	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
2	E7ENK3	620	949	0.380	0.362	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
3	E9PD61	620	920	0.380	0.374	E9PD61_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
4	F7AGW3	619	949	0.380	0.362	F7AGW3_MACMU Glutamate receptor OS=Macaca mulatta OX=9544 GN=GRIK1 PE=3 SV=2
5	H7BYG7	620	871	0.380	0.395	H7BYG7_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
6	P19490	1862	907	0.987	0.986	GRIA1_RAT Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2
7	P19491	1295	883	0.672	0.690	GRIA2_RAT Glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Gria2 PE=1 SV=2
8	P19492	1239	888	0.661	0.675	GRIA3_RAT Glutamate receptor 3 OS=Rattus norvegicus OX=10116 GN=Gria3 PE=1 SV=1
9	P19493	1276	902	0.674	0.677	GRIA4_RAT Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1
10	P22756	612	949	0.382	0.365	GRIK1_RAT Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3
11	P23818	1845	907	0.979	0.978	GRIA1_MOUSE Glutamate receptor 1 OS=Mus musculus OX=10090 GN=Gria1 PE=1 SV=1
12	P23819	1295	883	0.672	0.690	GRIA2_MOUSE Glutamate receptor 2 OS=Mus musculus OX=10090 GN=Gria2 PE=1 SV=3
13	P34299	551	962	0.364	0.343	GLR1_CAEEL Glutamate receptor 1 OS=Caenorhabditis elegans OX=6239 GN=glr-1 PE=1 SV=2
14	P39086	629	918	0.390	0.385	GRIK1_HUMAN Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
15	P39087	639	908	0.387	0.387	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
16	P42260	639	908	0.390	0.389	GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus OX=10116 GN=Grik2 PE=1 SV=2
17	P42261	1888	906	1.000	1.000	GRIA1_HUMAN Glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GRIA1 PE=1 SV=2
18	P42262	1298	883	0.673	0.691	GRIA2_HUMAN Glutamate receptor 2 OS=Homo sapiens OX=9606 GN=GRIA2 PE=1 SV=3
19	P42263	1244	894	0.661	0.670	GRIA3_HUMAN Glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRIA3 PE=1 SV=2
20	P42264	626	919	0.379	0.373	GRIK3_RAT Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus OX=10116 GN=Grik3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	2.4e-67	239.2	Receptor family ligand binding region
2	PF09834 DUF2061	2.2e+02	13.8	Predicted membrane protein (DUF2061)
3	PF04937 DUF659	77	14.5	Protein of unknown function (DUF 659)
4	PF00060 Lig_chan	6e-56	199.9	Ligand-gated ion channel
5	PF10613 Lig_chan-Glu_bd	2.7e-41	151.7	Ligated ion channel L-glutamate- and glycine-binding site
6	PF13458 Peripla_BP_6	1.6e+02	13.4	Periplasmic binding protein
7	PF00497 SBP_bac_3	6.9e-21	86.3	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000029795

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000028407	0.997	Uncharacterized protein
2	9598.ENSPTRP00000024653	0.993	Multifunctional fusion protein
3	9598.ENSPTRP00000027175	0.978	Discs, large homolog 1
4	9598.ENSPTRP00000038297	0.962	Uncharacterized protein
5	9598.ENSPTRP00000048500	0.954	Multifunctional fusion protein
6	9598.ENSPTRP00000014780	0.936	Uncharacterized protein
7	9598.ENSPTRP00000023095	0.931	Erythrocyte membrane protein band 4.1-like 1
8	9598.ENSPTRP00000024729	0.928	Protein interacting with PRKCA 1
9	9598.ENSPTRP00000058073	0.903	Discs, large homolog 2 (Drosophila)
10	9598.ENSPTRP00000056518	0.902	Glutamate receptor interacting protein 1
11	9598.ENSPTRP00000006750	0.888	Uncharacterized protein
12	9598.ENSPTRP00000037814	0.887	Discs, large homolog 3 (Drosophila)
13	9598.ENSPTRP00000052611	0.879	A kinase (PRKA) anchor protein 5
14	9598.ENSPTRP00000016236	0.872	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
15	9598.ENSPTRP00000029757	0.870	Calcium/calmodulin-dependent protein kinase II alpha
16	9598.ENSPTRP00000021413	0.864	Kinesin-like protein
17	9598.ENSPTRP00000046464	0.864	Kinesin-like protein
18	9598.ENSPTRP00000008740	0.859	Uncharacterized protein
19	9598.ENSPTRP00000018062	0.825	Belongs to the protein kinase superfamily.
20	9598.ENSPTRP00000042330	0.824	Belongs to the protein kinase superfamily.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0022890	0.999	inorganic cation transmembrane transporter activity
GO:0004970	0.999	ionotropic glutamate receptor activity
GO:0098960	0.922	postsynaptic neurotransmitter receptor activity
GO:0008324	0.921	monoatomic cation transmembrane transporter activity
GO:0042802	0.919	identical protein binding
GO:0019904	0.918	protein domain specific binding
GO:0099529	0.913	neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential
GO:0005261	0.904	monoatomic cation channel activity
GO:1904315	0.900	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0099507	0.874	ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:0030165	0.837	PDZ domain binding
GO:0046873	0.808	metal ion transmembrane transporter activity
GO:1901702	0.792	salt transmembrane transporter activity
GO:0099094	0.786	ligand-gated monoatomic cation channel activity
GO:0033218	0.763	amide binding
GO:0004971	0.733	AMPA glutamate receptor activity
GO:0019899	0.684	enzyme binding
GO:0005102	0.427	signaling receptor binding
GO:0019900	0.328	kinase binding
GO:0001540	0.308	amyloid-beta binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.992	regulation of biological process
GO:0050794	0.975	regulation of cellular process
GO:0032501	0.966	multicellular organismal process
GO:0099536	0.919	synaptic signaling
GO:0098916	0.913	anterograde trans-synaptic signaling
GO:0050896	0.906	response to stimulus
GO:0007268	0.898	chemical synaptic transmission
GO:0051716	0.877	cellular response to stimulus
GO:0010646	0.776	regulation of cell communication
GO:0023051	0.775	regulation of signaling
GO:0048519	0.664	negative regulation of biological process
GO:0065008	0.656	regulation of biological quality
GO:0099177	0.549	regulation of trans-synaptic signaling
GO:0032502	0.527	developmental process
GO:0051179	0.500	localization
GO:0007165	0.489	signal transduction
GO:0003008	0.473	system process
GO:0051234	0.457	establishment of localization
GO:0048856	0.456	anatomical structure development
GO:0006810	0.454	transport
GO:0007275	0.451	multicellular organism development
GO:0048518	0.428	positive regulation of biological process
GO:0008152	0.391	metabolic process
GO:0050877	0.378	nervous system process
GO:0048731	0.367	system development
GO:0048522	0.362	positive regulation of cellular process
GO:0050804	0.360	modulation of chemical synaptic transmission
GO:0042221	0.347	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.998	organelle
GO:0032991	0.997	protein-containing complex
GO:0043005	0.997	neuron projection
GO:0098794	0.996	postsynapse
GO:0097060	0.995	synaptic membrane
GO:0005622	0.993	intracellular anatomical structure
GO:0030425	0.987	dendrite
GO:0098978	0.985	glutamatergic synapse
GO:0098797	0.985	plasma membrane protein complex
GO:0099572	0.984	postsynaptic specialization
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0012505	0.980	endomembrane system
GO:0098793	0.980	presynapse
GO:0005737	0.979	cytoplasm
GO:0032279	0.978	asymmetric synapse
GO:0098802	0.976	plasma membrane signaling receptor complex
GO:0034702	0.975	ion channel complex
GO:0045211	0.975	postsynaptic membrane
GO:0008328	0.972	ionotropic glutamate receptor complex
GO:0014069	0.971	postsynaptic density
GO:0031090	0.963	organelle membrane
GO:0044297	0.956	cell body
GO:0031982	0.955	vesicle
GO:0043025	0.952	neuronal cell body
GO:0042734	0.952	presynaptic membrane
GO:0031410	0.952	cytoplasmic vesicle
GO:0032281	0.936	AMPA glutamate receptor complex
GO:0098588	0.920	bounding membrane of organelle
GO:0030659	0.920	cytoplasmic vesicle membrane
GO:0098839	0.909	postsynaptic density membrane
GO:0043197	0.906	dendritic spine
GO:0031256	0.831	leading edge membrane
GO:0032589	0.790	neuron projection membrane
GO:0032590	0.765	dendrite membrane
GO:0048786	0.756	presynaptic active zone
GO:0048787	0.732	presynaptic active zone membrane
GO:0030658	0.623	transport vesicle membrane
GO:0005783	0.617	endoplasmic reticulum
GO:0005576	0.518	extracellular region
GO:0030424	0.367	axon
GO:0070013	0.317	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]