StarFunc result for job id P42262

User Input

>input (883 residues)
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLL
DKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4u1wA	0.651	0.773	0.000	731	0.804	0.971	4u1wA.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
2	PDB:4u1xC	0.725	0.839	0.000	755	0.831	0.972	4u1xC.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
3	PDB:4uq6B	0.434	0.604	0.000	632	0.707	0.987	4uq6B.pdb.gz	Structural Mechanism of Glutamate Receptor Activation and Desensitization
4	PDB:5idfB	0.413	0.494	0.000	734	0.612	0.736	5idfB.pdb.gz
5	PDB:5kbtA	0.740	0.674	0.000	973	0.865	0.785	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
6	PDB:5weoA	0.761	0.682	0.000	988	0.881	0.787	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
7	PDB:7ocaA	0.547	0.609	0.000	775	0.650	0.741	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
8	PDB:7rz4A	0.736	0.658	0.000	993	0.883	0.785	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
9	PDB:7rzaA	0.727	0.658	0.000	981	0.879	0.791	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
10	AFDB:A0A0R4ING5	0.940	0.920	0.000	903	0.829	0.811	A0A0R4ING5.pdb.gz
11	AFDB:B3DGZ2	0.897	0.883	0.000	898	0.687	0.676	B3DGZ2.pdb.gz
12	AFDB:P19490	0.746	0.729	0.000	907	0.692	0.674	P19490.pdb.gz	GRIA1_RAT Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2
13	AFDB:P19491	0.964	0.964	0.000	883	0.995	0.995	P19491.pdb.gz	GRIA2_RAT Glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Gria2 PE=1 SV=2
14	AFDB:P19493	0.593	0.582	0.000	902	0.711	0.696	P19493.pdb.gz	GRIA4_RAT Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1
15	AFDB:P42263	0.491	0.486	0.000	894	0.719	0.710	P42263.pdb.gz	GRIA3_HUMAN Glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRIA3 PE=1 SV=2
16	AFDB:Q03445	0.589	0.538	2.267E-91	991	0.421	0.375	Q03445.pdb.gz	GLR1_DROME Glutamate receptor 1 OS=Drosophila melanogaster OX=7227 GN=GluRIA PE=1 SV=2
17	AFDB:E7ENK3	0.681	0.640	6.146E-87	949	0.390	0.362	E7ENK3.pdb.gz	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
18	AFDB:Q9VDH5	0.601	0.619	1.443E-84	853	0.366	0.379	Q9VDH5.pdb.gz	Q9VDH5_DROME Kainate-type ionotropic glutamate receptor subunit 1D OS=Drosophila melanogaster OX=7227 GN=KaiR1D PE=1 SV=1
19	AFDB:P39087	0.612	0.597	1.896E-84	908	0.387	0.377	P39087.pdb.gz	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
20	PDB:4uqqA	0.584	0.717	8.126E-67	693	0.316	0.403	4uqqA.pdb.gz	Structural Mechanism of Glutamate Receptor Activation and Desensitization

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	B1AS29	613	919	0.387	0.372	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
2	E7ENK3	599	949	0.392	0.365	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
3	E9PD61	599	920	0.392	0.376	E9PD61_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
4	F7AGW3	599	949	0.386	0.359	F7AGW3_MACMU Glutamate receptor OS=Macaca mulatta OX=9544 GN=GRIK1 PE=3 SV=2
5	H7BYG7	599	871	0.392	0.397	H7BYG7_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
6	P19490	1293	907	0.684	0.666	GRIA1_RAT Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2
7	P19491	1818	883	0.995	0.995	GRIA2_RAT Glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Gria2 PE=1 SV=2
8	P19492	1355	888	0.726	0.722	GRIA3_RAT Glutamate receptor 3 OS=Rattus norvegicus OX=10116 GN=Gria3 PE=1 SV=1
9	P19493	1356	902	0.720	0.705	GRIA4_RAT Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1
10	P22756	592	949	0.391	0.364	GRIK1_RAT Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3
11	P23818	1274	907	0.677	0.659	GRIA1_MOUSE Glutamate receptor 1 OS=Mus musculus OX=10090 GN=Gria1 PE=1 SV=1
12	P23819	1819	883	0.997	0.997	GRIA2_MOUSE Glutamate receptor 2 OS=Mus musculus OX=10090 GN=Gria2 PE=1 SV=3
13	P39086	599	918	0.392	0.377	GRIK1_HUMAN Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
14	P39087	631	908	0.398	0.387	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
15	P42260	632	908	0.398	0.387	GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus OX=10116 GN=Grik2 PE=1 SV=2
16	P42261	1298	906	0.691	0.673	GRIA1_HUMAN Glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GRIA1 PE=1 SV=2
17	P42262	1828	883	1.000	1.000	GRIA2_HUMAN Glutamate receptor 2 OS=Homo sapiens OX=9606 GN=GRIA2 PE=1 SV=3
18	P42263	1355	894	0.725	0.716	GRIA3_HUMAN Glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRIA3 PE=1 SV=2
19	P42264	616	919	0.388	0.373	GRIK3_RAT Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus OX=10116 GN=Grik3 PE=1 SV=1
20	P48058	1337	902	0.711	0.696	GRIA4_HUMAN Glutamate receptor 4 OS=Homo sapiens OX=9606 GN=GRIA4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	8e-57	204.6	Receptor family ligand binding region
2	PF09834 DUF2061	3e+02	13.3	Predicted membrane protein (DUF2061)
3	PF00060 Lig_chan	1.3e-55	198.8	Ligand-gated ion channel
4	PF10613 Lig_chan-Glu_bd	2.1e-42	155.3	Ligated ion channel L-glutamate- and glycine-binding site
5	PF13458 Peripla_BP_6	2.7	19.3	Periplasmic binding protein
6	PF00497 SBP_bac_3	1.5e-21	88.4	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007689

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000018295	0.999	Glutamate receptor, ionotropic, AMPA 3
2	61853.ENSNLEP00000020057	0.999	Glutamate receptor, ionotropic, AMPA 1
3	61853.ENSNLEP00000017831	0.997	Multifunctional fusion protein
4	61853.ENSNLEP00000018251	0.994	Protein interacting with PRKCA 1
5	61853.ENSNLEP00000004095	0.991	Glutamate receptor interacting protein 1
6	61853.ENSNLEP00000008788	0.991	Glutamate receptor, ionotropic, AMPA 4
7	61853.ENSNLEP00000014471	0.984	Calcium channel, voltage-dependent, gamma subunit 3
8	61853.ENSNLEP00000007571	0.983	Multifunctional fusion protein
9	61853.ENSNLEP00000009746	0.976	Discs, large homolog 4 (Drosophila)
10	61853.ENSNLEP00000006217	0.960	Glutamate receptor interacting protein 2
11	61853.ENSNLEP00000016514	0.958	Cornichon family AMPA receptor auxiliary protein 3
12	61853.ENSNLEP00000007347	0.955	Cornichon family AMPA receptor auxiliary protein 2
13	61853.ENSNLEP00000000297	0.952	Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit (By similarity). Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs), including GRIA1 and GRIA4. Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization
14	61853.ENSNLEP00000011061	0.949	Glutamate receptor, ionotropic, N-methyl D-aspartate 1
15	61853.ENSNLEP00000014592	0.947	Olfactomedin 2
16	61853.ENSNLEP00000001169	0.938	Discs, large homolog 3 (Drosophila)
17	61853.ENSNLEP00000012325	0.937	Glutamate receptor, ionotropic, N-methyl D-aspartate 2A
18	61853.ENSNLEP00000004561	0.936	Glutamate receptor, ionotropic, N-methyl D-aspartate 2B
19	61853.ENSNLEP00000000305	0.930	Multifunctional fusion protein
20	61853.ENSNLEP00000007568	0.930	Multifunctional fusion protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0022890	0.999	inorganic cation transmembrane transporter activity
GO:0004970	0.999	ionotropic glutamate receptor activity
GO:1904315	0.967	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0005261	0.961	monoatomic cation channel activity
GO:0046873	0.935	metal ion transmembrane transporter activity
GO:1901702	0.930	salt transmembrane transporter activity
GO:0099094	0.922	ligand-gated monoatomic cation channel activity
GO:0042802	0.912	identical protein binding
GO:0099507	0.908	ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:0030165	0.890	PDZ domain binding
GO:0005272	0.789	sodium channel activity
GO:0033218	0.773	amide binding
GO:0004971	0.702	AMPA glutamate receptor activity
GO:0019899	0.584	enzyme binding
GO:0005267	0.555	potassium channel activity
GO:0001540	0.528	amyloid-beta binding
GO:0015277	0.516	kainate selective glutamate receptor activity
GO:0019901	0.450	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.991	biological regulation
GO:0050896	0.977	response to stimulus
GO:0050794	0.975	regulation of cellular process
GO:0032501	0.959	multicellular organismal process
GO:0098916	0.956	anterograde trans-synaptic signaling
GO:0007268	0.947	chemical synaptic transmission
GO:0051716	0.835	cellular response to stimulus
GO:0032502	0.570	developmental process
GO:0051179	0.550	localization
GO:0099177	0.544	regulation of trans-synaptic signaling
GO:0048856	0.531	anatomical structure development
GO:0007275	0.522	multicellular organism development
GO:0050804	0.507	modulation of chemical synaptic transmission
GO:0048731	0.468	system development
GO:0007399	0.444	nervous system development
GO:0065008	0.426	regulation of biological quality
GO:0006810	0.419	transport
GO:0048518	0.386	positive regulation of biological process
GO:0042221	0.332	response to chemical
GO:0048522	0.322	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0098794	0.998	postsynapse
GO:0098797	0.997	plasma membrane protein complex
GO:0097060	0.997	synaptic membrane
GO:0036477	0.996	somatodendritic compartment
GO:0005737	0.995	cytoplasm
GO:0043005	0.995	neuron projection
GO:0030425	0.993	dendrite
GO:0098793	0.988	presynapse
GO:0008328	0.988	ionotropic glutamate receptor complex
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0014069	0.987	postsynaptic density
GO:0098978	0.984	glutamatergic synapse
GO:0045211	0.983	postsynaptic membrane
GO:0012505	0.980	endomembrane system
GO:0031410	0.980	cytoplasmic vesicle
GO:0031090	0.978	organelle membrane
GO:0032281	0.972	AMPA glutamate receptor complex
GO:0030659	0.959	cytoplasmic vesicle membrane
GO:0044297	0.956	cell body
GO:0098588	0.948	bounding membrane of organelle
GO:0099634	0.939	postsynaptic specialization membrane
GO:0098839	0.931	postsynaptic density membrane
GO:0042734	0.906	presynaptic membrane
GO:0044309	0.854	neuron spine
GO:0043197	0.839	dendritic spine
GO:0099503	0.826	secretory vesicle
GO:0048786	0.809	presynaptic active zone
GO:0030133	0.808	transport vesicle
GO:0030658	0.796	transport vesicle membrane
GO:0048787	0.793	presynaptic active zone membrane
GO:0008021	0.787	synaptic vesicle
GO:0030672	0.781	synaptic vesicle membrane
GO:0031256	0.757	leading edge membrane
GO:0031253	0.754	cell projection membrane
GO:0043025	0.744	neuronal cell body
GO:0032589	0.700	neuron projection membrane
GO:0030424	0.698	axon
GO:0030139	0.613	endocytic vesicle
GO:0005576	0.458	extracellular region
GO:0005783	0.447	endoplasmic reticulum
GO:0150034	0.370	distal axon
GO:0009986	0.367	cell surface
GO:0044306	0.304	neuron projection terminus
GO:0098685	0.300	Schaffer collateral - CA1 synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.789	Na(+)(in) = Na(+)(out)
RHEA:29463	0.555	K(+)(in) = K(+)(out)

[back to server]