StarFunc result for job id P42263

User Input

>input (894 residues)
MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKN
APLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKM
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASS
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKY
GARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPP
NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVER
MVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAD
GVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNL
AVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMM
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4u1xC	0.421	0.495	0.000	755	0.610	0.722	4u1xC.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
2	PDB:5idfB	0.563	0.669	0.000	734	0.808	0.984	5idfB.pdb.gz
3	PDB:5kbtA	0.434	0.400	0.000	973	0.642	0.590	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
4	PDB:5weoA	0.428	0.390	0.000	988	0.655	0.593	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
5	PDB:7ocaA	0.403	0.463	0.000	775	0.630	0.726	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
6	PDB:7rz4A	0.433	0.393	0.000	993	0.658	0.592	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
7	PDB:7rzaA	0.426	0.390	0.000	981	0.659	0.600	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
8	AFDB:A0A0R4ING5	0.485	0.482	0.000	903	0.671	0.664	A0A0R4ING5.pdb.gz
9	AFDB:B3DGZ2	0.482	0.481	0.000	898	0.699	0.696	B3DGZ2.pdb.gz
10	AFDB:P19490	0.586	0.578	0.000	907	0.672	0.663	P19490.pdb.gz	GRIA1_RAT Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2
11	AFDB:P19491	0.484	0.489	0.000	883	0.710	0.719	P19491.pdb.gz	GRIA2_RAT Glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Gria2 PE=1 SV=2
12	AFDB:P19493	0.793	0.787	0.000	902	0.719	0.713	P19493.pdb.gz	GRIA4_RAT Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1
13	AFDB:P42263	1.000	1.000	0.000	894	1.000	1.000	P42263.pdb.gz	GRIA3_HUMAN Glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRIA3 PE=1 SV=2
14	PDB:4u1wA	0.413	0.500	2.020E-101	731	0.605	0.740	4u1wA.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
15	PDB:4uq6B	0.414	0.580	5.040E-92	632	0.496	0.701	4uq6B.pdb.gz	Structural Mechanism of Glutamate Receptor Activation and Desensitization
16	AFDB:Q03445	0.414	0.380	2.381E-87	991	0.427	0.385	Q03445.pdb.gz	GLR1_DROME Glutamate receptor 1 OS=Drosophila melanogaster OX=7227 GN=GluRIA PE=1 SV=2
17	AFDB:P39087	0.497	0.491	2.952E-87	908	0.396	0.390	P39087.pdb.gz	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
18	AFDB:B1AS29	0.481	0.469	5.969E-86	919	0.387	0.376	B1AS29.pdb.gz	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
19	AFDB:E7ENK3	0.430	0.408	6.376E-84	949	0.384	0.361	E7ENK3.pdb.gz	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
20	PDB:4uqqA	0.415	0.523	4.548E-65	693	0.314	0.405	4uqqA.pdb.gz	Structural Mechanism of Glutamate Receptor Activation and Desensitization

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	B1AS29	609	919	0.384	0.373	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
2	E7ENK3	607	949	0.395	0.372	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
3	E9PD61	608	920	0.395	0.384	E9PD61_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
4	F7AGW3	608	949	0.395	0.372	F7AGW3_MACMU Glutamate receptor OS=Macaca mulatta OX=9544 GN=GRIK1 PE=3 SV=2
5	H7BYG7	607	871	0.395	0.405	H7BYG7_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
6	P19490	1241	907	0.670	0.660	GRIA1_RAT Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2
7	P19491	1353	883	0.716	0.725	GRIA2_RAT Glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Gria2 PE=1 SV=2
8	P19492	1846	888	0.988	0.994	GRIA3_RAT Glutamate receptor 3 OS=Rattus norvegicus OX=10116 GN=Gria3 PE=1 SV=1
9	P19493	1383	902	0.724	0.717	GRIA4_RAT Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1
10	P22756	599	949	0.393	0.370	GRIK1_RAT Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3
11	P23818	1222	907	0.661	0.652	GRIA1_MOUSE Glutamate receptor 1 OS=Mus musculus OX=10090 GN=Gria1 PE=1 SV=1
12	P23819	1354	883	0.716	0.725	GRIA2_MOUSE Glutamate receptor 2 OS=Mus musculus OX=10090 GN=Gria2 PE=1 SV=3
13	P39086	607	918	0.395	0.385	GRIK1_HUMAN Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
14	P39087	628	908	0.398	0.392	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
15	P42260	628	908	0.398	0.392	GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus OX=10116 GN=Grik2 PE=1 SV=2
16	P42261	1242	906	0.670	0.661	GRIA1_HUMAN Glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GRIA1 PE=1 SV=2
17	P42262	1355	883	0.716	0.725	GRIA2_HUMAN Glutamate receptor 2 OS=Homo sapiens OX=9606 GN=GRIA2 PE=1 SV=3
18	P42263	1869	894	1.000	1.000	GRIA3_HUMAN Glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRIA3 PE=1 SV=2
19	P42264	607	919	0.383	0.372	GRIK3_RAT Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus OX=10116 GN=Grik3 PE=1 SV=1
20	P48058	1364	902	0.715	0.708	GRIA4_HUMAN Glutamate receptor 4 OS=Homo sapiens OX=9606 GN=GRIA4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	4.3e-56	202.2	Receptor family ligand binding region
2	PF09834 DUF2061	1.7e+02	14.1	Predicted membrane protein (DUF2061)
3	PF00060 Lig_chan	1.7e-55	198.5	Ligand-gated ion channel
4	PF10613 Lig_chan-Glu_bd	6.1e-42	153.8	Ligated ion channel L-glutamate- and glycine-binding site
5	PF18298 NusG_add	1.5e+02	14.0	NusG additional domain
6	PF00497 SBP_bac_3	2.2e-20	84.6	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481554

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296526	0.995	Glutamate receptor 2
2	9606.ENSP00000385205	0.995	PRKCA-binding protein
3	9606.ENSP00000300105	0.986	Voltage-dependent calcium channel gamma-2 subunit
4	9606.ENSP00000381098	0.981	Glutamate receptor-interacting protein 1
5	9606.ENSP00000382428	0.978	Disks large homolog 4
6	9606.ENSP00000480660	0.964	Glutamate receptor-interacting protein 2
7	9606.ENSP00000381412	0.961	Calcium/calmodulin-dependent protein kinase type II subunit alpha
8	9606.ENSP00000428994	0.960	Glutamate receptor 1
9	9606.ENSP00000262138	0.953	Voltage-dependent calcium channel gamma-4 subunit
10	9606.ENSP00000270458	0.952	Voltage-dependent calcium channel gamma-8 subunit
11	9606.ENSP00000365272	0.951	Disks large homolog 2
12	9606.ENSP00000345731	0.949	Disks large homolog 1
13	9606.ENSP00000379098	0.948	Calcium/calmodulin-dependent protein kinase type II subunit beta
14	9606.ENSP00000363480	0.946	Disks large homolog 3
15	9606.ENSP00000319060	0.943	Calcium/calmodulin-dependent protein kinase type II subunit gamma
16	9606.ENSP00000005284	0.934	Voltage-dependent calcium channel gamma-3 subunit
17	9606.ENSP00000337168	0.933	Band 4.1-like protein 1
18	9606.ENSP00000381293	0.932	Vesicle-fusing ATPase
19	9606.ENSP00000339740	0.925	Calcium/calmodulin-dependent protein kinase type II subunit delta
20	9606.ENSP00000378207	0.925	A-kinase anchor protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0022890	0.999	inorganic cation transmembrane transporter activity
GO:0004970	0.999	ionotropic glutamate receptor activity
GO:0099529	0.902	neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential
GO:1904315	0.894	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0099507	0.872	ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:0008324	0.822	monoatomic cation transmembrane transporter activity
GO:0042277	0.780	peptide binding
GO:0005261	0.761	monoatomic cation channel activity
GO:0004971	0.702	AMPA glutamate receptor activity
GO:1901702	0.618	salt transmembrane transporter activity
GO:0099094	0.589	ligand-gated monoatomic cation channel activity
GO:0046873	0.580	metal ion transmembrane transporter activity
GO:0019899	0.382	enzyme binding
GO:0042802	0.332	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0023052	0.982	signaling
GO:0007154	0.982	cell communication
GO:0050896	0.974	response to stimulus
GO:0051716	0.919	cellular response to stimulus
GO:0007165	0.775	signal transduction
GO:0007215	0.767	glutamate receptor signaling pathway
GO:0042221	0.499	response to chemical
GO:0032501	0.493	multicellular organismal process
GO:0007267	0.410	cell-cell signaling
GO:0099536	0.366	synaptic signaling
GO:0007268	0.364	chemical synaptic transmission
GO:0051179	0.356	localization
GO:0051234	0.346	establishment of localization
GO:0048518	0.335	positive regulation of biological process
GO:0006810	0.320	transport
GO:0065008	0.307	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0005886	1.000	plasma membrane
GO:0005622	0.998	intracellular anatomical structure
GO:0030054	0.995	cell junction
GO:0005737	0.994	cytoplasm
GO:0098797	0.994	plasma membrane protein complex
GO:0045202	0.993	synapse
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0043235	0.988	receptor complex
GO:0034702	0.986	ion channel complex
GO:0120025	0.983	plasma membrane bounded cell projection
GO:0098590	0.983	plasma membrane region
GO:0036477	0.978	somatodendritic compartment
GO:0098794	0.977	postsynapse
GO:0008328	0.975	ionotropic glutamate receptor complex
GO:0097060	0.971	synaptic membrane
GO:0030425	0.968	dendrite
GO:0031090	0.953	organelle membrane
GO:0044297	0.951	cell body
GO:0099572	0.950	postsynaptic specialization
GO:0031982	0.942	vesicle
GO:0012505	0.927	endomembrane system
GO:0098984	0.922	neuron to neuron synapse
GO:0045211	0.920	postsynaptic membrane
GO:0098978	0.919	glutamatergic synapse
GO:0032281	0.913	AMPA glutamate receptor complex
GO:0014069	0.900	postsynaptic density
GO:0098839	0.819	postsynaptic density membrane
GO:0098793	0.811	presynapse
GO:0098588	0.702	bounding membrane of organelle
GO:0012506	0.694	vesicle membrane
GO:0031410	0.671	cytoplasmic vesicle
GO:0043025	0.644	neuronal cell body
GO:0030659	0.586	cytoplasmic vesicle membrane
GO:0044309	0.542	neuron spine
GO:0005576	0.520	extracellular region
GO:0043197	0.393	dendritic spine
GO:0005783	0.391	endoplasmic reticulum
GO:0060076	0.351	excitatory synapse
GO:0030139	0.309	endocytic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]