StarFunc result for job id P42285

User Input

>input (1042 residues)
MADAFGDELFSVFEGDSTTAAGTKKDKEKDKGKWKGPPGSADKAGKRFDGKLQSESTNNG
KNKRDVDFEGTDEPIFGKKPRIEESITEDLSLADLMPRVKVQSVETVEGCTHEVALPAEE
DYLPLKPRVGKAAKEYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALR
EKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGS
EVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLH
KQPCHVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGD
QKGRKGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMV
EEVFSNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALF
ATETFAMGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVD
EKMSPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPG
VVEKVKNSEEQYNKIVIPNEESVVIYYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLV
KVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLRCSKESLKNSATEAAKPAKP
DEKGEMQVVPVLVHLLSAISSVRLYIPKDLRPVDNRQSVLKSIQEVQKRFPDGIPLLDPI
DDMGIQDQGLKKVIQKVEAFEHRMYSHPLHNDPNLETVYTLCEKKAQIAIDIKSAKRELK
KARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDL
SAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAEAKLEIDEETYLS
SFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELE
NKFAEGITKIKRDIVFAASLYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6iegA	0.698	0.824	0.000	872	0.831	0.993	6iegA.pdb.gz	NRDE2 negatively regulates exosome functions by inhibiting MTR4 recruitment and exosome interaction.
2	PDB:6ro1A	0.673	0.762	0.000	919	0.879	0.997	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
3	PDB:7z4yB	0.718	0.793	0.000	930	0.891	0.998	7z4yB.pdb.gz
4	AFDB:F1QD61	0.935	0.943	0.000	1034	0.853	0.860	F1QD61.pdb.gz
5	AFDB:O14232	0.685	0.642	0.000	1117	0.560	0.522	O14232.pdb.gz	MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtr4 PE=1 SV=1
6	AFDB:P42285	1.000	1.000	0.000	1042	1.000	1.000	P42285.pdb.gz	MTREX_HUMAN Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3
7	AFDB:P47047	0.704	0.684	0.000	1073	0.524	0.509	P47047.pdb.gz	MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTR4 PE=1 SV=1
8	AFDB:Q9Y134	0.714	0.706	0.000	1055	0.629	0.621	Q9Y134.pdb.gz	Q9Y134_DROME L.2.35Df OS=Drosophila melanogaster OX=7227 GN=Mtr4 PE=1 SV=1
9	AFDB:Q873J5	0.723	0.684	5.268E-103	1106	0.508	0.478	Q873J5.pdb.gz	Q873J5_NEUCS FRQ-interacting RNA helicase OS=Neurospora crassa OX=5141 GN=B9B11.040 PE=1 SV=1
10	AFDB:Q9ZVW2	0.787	0.822	3.971E-100	995	0.492	0.516	Q9ZVW2.pdb.gz	HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana OX=3702 GN=HEN2 PE=1 SV=2
11	AFDB:Q9XIF2	0.720	0.757	7.737E-100	988	0.504	0.531	Q9XIF2.pdb.gz	MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana OX=3702 GN=MTR4 PE=2 SV=1
12	AFDB:O13799	0.663	0.671	7.472E-99	1030	0.461	0.466	O13799.pdb.gz	YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17H9.02 PE=1 SV=1
13	PDB:6d6qM	0.667	0.976	4.722E-90	709	0.679	0.997	6d6qM.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
14	PDB:4xgtA	0.679	0.733	1.256E-89	961	0.488	0.530	4xgtA.pdb.gz
15	AFDB:Q38AL9	0.728	0.792	1.577E-85	950	0.424	0.465	Q38AL9.pdb.gz	Q38AL9_TRYB2 ATP-dependent DEAD/H RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3220 PE=4 SV=1
16	PDB:7d4iM4	0.641	0.682	1.086E-81	978	0.501	0.534	7d4iM4.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
17	PDB:2xgjB	0.686	0.909	2.417E-81	777	0.441	0.592	2xgjB.pdb.gz	Structural Analysis Reveals the Characteristic Features of Mtr4, a Dexh Helicase Involved in Nuclear RNA Processing and Surveillance.
18	PDB:6lqsM4	0.690	0.812	8.133E-75	874	0.478	0.570	6lqsM4.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
19	PDB:7qdyA	0.616	0.550	2.144E-61	1169	0.342	0.305	7qdyA.pdb.gz	The human SKI complex regulates channeling of ribosome-bound RNA to the exosome via an intrinsic gatekeeping mechanism.
20	PDB:5mc6h	0.609	0.567	2.645E-53	1121	0.331	0.308	5mc6h.pdb.gz	The cryo-EM structure of a ribosome-Ski2-Ski3-Ski8 helicase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F4JAA5	0.0	596	1347	0.348	0.269	SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana OX=3702 GN=SKI2 PE=1 SV=1
2	O13799	0.0	954	1030	0.452	0.457	YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17H9.02 PE=1 SV=1
3	O14232	0.0	1164	1117	0.540	0.504	MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtr4 PE=1 SV=1
4	O59801	0.0	575	1213	0.333	0.286	SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.03c PE=3 SV=1
5	P42285	0.0	2165	1042	1.000	1.000	MTREX_HUMAN Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3
6	P47047	0.0	1084	1073	0.509	0.494	MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTR4 PE=1 SV=1
7	Q15477	0.0	588	1246	0.351	0.294	SKI2_HUMAN Superkiller complex protein 2 OS=Homo sapiens OX=9606 GN=SKIC2 PE=1 SV=3
8	Q38AL9	0.0	841	950	0.430	0.472	Q38AL9_TRYB2 ATP-dependent DEAD/H RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3220 PE=4 SV=1
9	Q6P7X6	0.0	1845	1034	0.850	0.857	Q6P7X6_DANRE Superkiller viralicidic activity 2-like 2 OS=Danio rerio OX=7955 GN=skiv2l2 PE=1 SV=1
10	Q873J5	0.0	1039	1106	0.507	0.477	Q873J5_NEUCS FRQ-interacting RNA helicase OS=Neurospora crassa OX=5141 GN=B9B11.040 PE=1 SV=1
11	Q9XIF2	0.0	1080	988	0.508	0.535	MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana OX=3702 GN=MTR4 PE=2 SV=1
12	Q9Y134	0.0	1371	1055	0.614	0.607	Q9Y134_DROME L.2.35Df OS=Drosophila melanogaster OX=7227 GN=Mtr4 PE=1 SV=1
13	Q9ZVW2	0.0	1004	995	0.486	0.509	HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana OX=3702 GN=HEN2 PE=1 SV=2
14	P35207	2.02e-171	538	1287	0.337	0.273	SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI2 PE=1 SV=2
15	Q9VCH8	2.53e-171	536	1197	0.329	0.287	Q9VCH8_DROME LD23303p OS=Drosophila melanogaster OX=7227 GN=tst PE=2 SV=2
16	Q9BI21	6.60e-171	535	1197	0.328	0.286	Q9BI21_DROME Putative helicase Ski2 OS=Drosophila melanogaster OX=7227 GN=tst PE=2 SV=1
17	P9WMR1	3.64e-93	319	906	0.176	0.202	HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=helY PE=1 SV=1
18	B9DFG3	3.87e-71	260	1171	0.172	0.153	ISE2_ARATH DExH-box ATP-dependent RNA helicase DExH15 chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISE2 PE=1 SV=2
19	Q588V7	3.53e-30	132	2154	0.116	0.056	TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana OX=3702 GN=TEB PE=2 SV=1
20	D3Z4R1	1.45e-28	126	1434	0.107	0.077	HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus OX=10090 GN=Hfm1 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13245 AAA_19	59	15.3	AAA domain
2	PF13401 AAA_22	1.3e+02	14.3	AAA domain
3	PF00270 DEAD	9.5e-14	63.1	DEAD/DEAH box helicase
4	PF08148 DSHCT	5.7e-53	190.4	DSHCT (NUC185) domain
5	PF00271 Helicase_C	0.00042	32.0	Helicase conserved C-terminal domain
6	PF13234 rRNA_proc-arch	2.1e-84	295.2	rRNA-processing arch domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000230640

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221233	0.999	Exosome complex component RRP46
2	9606.ENSP00000225298	0.999	U3 small nucleolar RNA-associated protein 18 homolog
3	9606.ENSP00000265564	0.999	Exosome complex component RRP42
4	9606.ENSP00000315476	0.999	Exosome complex component RRP41
5	9606.ENSP00000323046	0.999	Exosome complex component RRP40
6	9606.ENSP00000361433	0.999	Exosome complex component RRP4
7	9606.ENSP00000366135	0.999	Exosome component 10
8	9606.ENSP00000366997	0.999	Exosome complex exonuclease RRP44
9	9606.ENSP00000368984	0.999	Exosome complex component RRP45
10	9606.ENSP00000374354	0.999	Exosome complex component RRP43
11	9606.ENSP00000398597	0.999	Exosome complex component MTR3
12	9606.ENSP00000438993	0.999	Zinc finger CCHC domain-containing protein 8
13	9606.ENSP00000230859	0.998	Non-canonical poly(A) RNA polymerase PAPD7
14	9606.ENSP00000358812	0.998	Protein RRP5 homolog
15	9606.ENSP00000364639	0.998	RNA-binding protein 7
16	9606.ENSP00000443113	0.998	Zinc finger CCHC-type containing 7
17	9606.ENSP00000264279	0.997	Nucleolar protein 58
18	9606.ENSP00000308179	0.997	WD repeat-containing protein 3
19	9606.ENSP00000321711	0.997	DIS3-like exonuclease 1
20	9606.ENSP00000359939	0.997	Exosome complex component CSL4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0035639	1.000	purine ribonucleoside triphosphate binding
GO:0003724	1.000	RNA helicase activity
GO:0032559	0.999	adenyl ribonucleotide binding
GO:0005524	0.991	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0090304	0.986	nucleic acid metabolic process
GO:0016070	0.984	RNA metabolic process
GO:0006396	0.965	RNA processing
GO:0050789	0.955	regulation of biological process
GO:0050794	0.885	regulation of cellular process
GO:0016071	0.696	mRNA metabolic process
GO:0048518	0.552	positive regulation of biological process
GO:0071840	0.524	cellular component organization or biogenesis
GO:0048522	0.523	positive regulation of cellular process
GO:0022613	0.492	ribonucleoprotein complex biogenesis
GO:0019222	0.476	regulation of metabolic process
GO:0044260	0.469	cellular macromolecule metabolic process
GO:0034660	0.447	ncRNA metabolic process
GO:0060255	0.365	regulation of macromolecule metabolic process
GO:0042254	0.345	ribosome biogenesis
GO:0034470	0.333	ncRNA processing
GO:0050896	0.327	response to stimulus
GO:0006397	0.321	mRNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0140513	0.993	nuclear protein-containing complex
GO:0043232	0.947	intracellular non-membrane-bounded organelle
GO:1902494	0.943	catalytic complex
GO:1990904	0.822	ribonucleoprotein complex
GO:0005681	0.734	spliceosomal complex
GO:0005737	0.718	cytoplasm
GO:1905354	0.696	exoribonuclease complex
GO:0071013	0.676	catalytic step 2 spliceosome
GO:0000178	0.438	exosome (RNase complex)
GO:0031499	0.329	TRAMP complex
GO:0000176	0.312	nuclear exosome (RNase complex)

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	1.000	RNA helicase.

[back to server]