StarFunc result for job id P42330

User Input

>input (323 residues)
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42330	1.000	1.000	4.205E-70	323	1.000	1.000	P42330.pdb.gz	AK1C3_HUMAN Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3 PE=1 SV=4
2	PDB:4zfcB	0.981	0.990	5.376E-65	320	0.991	1.000	4zfcB.pdb.gz	In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
3	AFDB:P52895	0.995	0.995	1.186E-62	323	0.870	0.870	P52895.pdb.gz	AK1C2_HUMAN Aldo-keto reductase family 1 member C2 OS=Homo sapiens OX=9606 GN=AKR1C2 PE=1 SV=3
4	AFDB:P17516	0.992	0.992	1.127E-60	323	0.839	0.839	P17516.pdb.gz	AK1C4_HUMAN Aldo-keto reductase family 1 member C4 OS=Homo sapiens OX=9606 GN=AKR1C4 PE=1 SV=3
5	PDB:2fvlA	0.994	0.994	1.181E-60	323	0.842	0.842	2fvlA.pdb.gz	Crystal structure of human 3-alpha hydroxysteroid/dihydrodiol dehydrogenase (AKR1C4) complexed with NADP+
6	PDB:4l1wA	0.988	0.982	4.622E-59	325	0.867	0.862	4l1wA.pdb.gz	Human 3-alpha hydroxysteroid dehydrogenase type 3 (3 alpha-HSD3): The V54L mutation restricting the steroid alternative binding and enhancing the 20 alpha-HSD activity
7	AFDB:P70694	0.997	0.997	2.055E-58	323	0.755	0.755	P70694.pdb.gz	DHB5_MOUSE Estradiol 17 beta-dehydrogenase 5 OS=Mus musculus OX=10090 GN=Akr1c6 PE=1 SV=1
8	AFDB:Q3MHS3	0.994	0.994	3.499E-58	323	0.734	0.734	Q3MHS3.pdb.gz	Q3MHS3_RAT Aldo-keto reductase family 1, member C1 OS=Rattus norvegicus OX=10116 GN=Akr1c1 PE=1 SV=1
9	AFDB:Q91WR5	0.991	0.991	7.180E-56	323	0.721	0.721	Q91WR5.pdb.gz	AK1CL_MOUSE Aldo-keto reductase family 1 member C21 OS=Mus musculus OX=10090 GN=Akr1c21 PE=1 SV=2
10	AFDB:P23457	0.990	0.993	1.376E-55	322	0.697	0.699	P23457.pdb.gz	DIDH_RAT 3-alpha-hydroxysteroid dehydrogenase OS=Rattus norvegicus OX=10116 GN=Akr1c9 PE=1 SV=1
11	AFDB:D3ZF77	0.984	0.981	2.969E-55	324	0.693	0.691	D3ZF77.pdb.gz	AK1CA_RAT Aldo-keto reductase family 1 member C15 OS=Rattus norvegicus OX=10116 GN=Akr1c15 PE=1 SV=1
12	AFDB:P51652	0.990	0.990	2.969E-55	323	0.712	0.712	P51652.pdb.gz	AKC1H_RAT Aldo-keto reductase family 1 member C18 OS=Rattus norvegicus OX=10116 GN=Akr1c18 PE=1 SV=1
13	AFDB:Q91WT7	0.987	0.987	3.150E-55	323	0.693	0.693	Q91WT7.pdb.gz	Q91WT7_MOUSE 3-alpha-hydroxysteroid dehydrogenase type 1 OS=Mus musculus OX=10090 GN=Akr1c14 PE=1 SV=1
14	PDB:3cv6A	0.983	0.983	3.957E-54	323	0.721	0.721	3cv6A.pdb.gz	Structure of the G225P/G226P mutant of mouse 3(17)alpha-hydroxysteroid dehydrogenase (AKR1C21) ternary complex: implications for the binding of inhibitor and substrate.
15	PDB:1afsA	0.970	0.982	1.218E-53	319	0.690	0.699	1afsA.pdb.gz	Steroid recognition and regulation of hormone action: crystal structure of testosterone and NADP+ bound to 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase.
16	PDB:3ln3A	0.969	0.981	1.376E-52	319	0.638	0.646	3ln3A.pdb.gz	Crystal structure of Putative reductase (NP_038806.2) from MUS MUSCULUS at 1.18 A resolution
17	PDB:3burA	0.984	0.978	3.036E-47	325	0.551	0.548	3burA.pdb.gz	Crystal Structure of Human Liver {Delta}4-3-Ketosteroid 5{beta}-Reductase (AKR1D1) and Implications for Substrate Binding and Catalysis.
18	PDB:3rx2A	0.941	0.956	2.770E-41	318	0.464	0.472	3rx2A.pdb.gz	The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase
19	PDB:4gq0A	0.945	0.959	8.033E-41	318	0.461	0.469	4gq0A.pdb.gz	Crystal structure of AKR1B10 complexed with NADP+ and Caffeic acid phenethyl ester
20	PDB:3o3rA	0.941	0.965	6.396E-39	315	0.452	0.463	3o3rA.pdb.gz	Structure of rat aldose reductase-like protein AKR1B14 holoenzyme: Probing the role of His269 in coenzyme binding by site-directed mutagenesis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17516	0.0	569	323	0.839	0.839	AK1C4_HUMAN Aldo-keto reductase family 1 member C4 OS=Homo sapiens OX=9606 GN=AKR1C4 PE=1 SV=3
2	P42330	0.0	674	323	1.000	1.000	AK1C3_HUMAN Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3 PE=1 SV=4
3	P52895	0.0	588	323	0.870	0.870	AK1C2_HUMAN Aldo-keto reductase family 1 member C2 OS=Homo sapiens OX=9606 GN=AKR1C2 PE=1 SV=3
4	P70694	0.0	530	323	0.755	0.755	DHB5_MOUSE Estradiol 17 beta-dehydrogenase 5 OS=Mus musculus OX=10090 GN=Akr1c6 PE=1 SV=1
5	Q04828	0.0	595	323	0.879	0.879	AK1C1_HUMAN Aldo-keto reductase family 1 member C1 OS=Homo sapiens OX=9606 GN=AKR1C1 PE=1 SV=1
6	Q3MHS3	0.0	509	323	0.734	0.734	Q3MHS3_RAT Aldo-keto reductase family 1, member C1 OS=Rattus norvegicus OX=10116 GN=Akr1c1 PE=1 SV=1
7	Q5I0L1	0.0	507	322	0.731	0.733	Q5I0L1_RAT Akr1c1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Akr1c1 PE=2 SV=1
8	Q8K023	0.0	504	323	0.734	0.734	AKC1H_MOUSE Aldo-keto reductase family 1 member C18 OS=Mus musculus OX=10090 GN=Akr1c18 PE=1 SV=2
9	P51652	1.47e-177	496	323	0.712	0.712	AKC1H_RAT Aldo-keto reductase family 1 member C18 OS=Rattus norvegicus OX=10116 GN=Akr1c18 PE=1 SV=1
10	Q1HE49	1.95e-177	495	322	0.712	0.714	Q1HE49_PIG Aldo-keto reductase family 1 member C4 OS=Sus scrofa OX=9823 GN=AKR1C4 PE=3 SV=1
11	Q2TJA5	6.50e-177	494	322	0.712	0.714	Q2TJA5_PIG Aldo-keto reductase OS=Sus scrofa OX=9823 GN=AKR1C8 PE=1 SV=1
12	Q91WR5	9.33e-176	491	323	0.721	0.721	AK1CL_MOUSE Aldo-keto reductase family 1 member C21 OS=Mus musculus OX=10090 GN=Akr1c21 PE=1 SV=2
13	Q91WT7	5.98e-173	484	323	0.693	0.693	Q91WT7_MOUSE 3-alpha-hydroxysteroid dehydrogenase type 1 OS=Mus musculus OX=10090 GN=Akr1c14 PE=1 SV=1
14	P23457	1.14e-172	483	322	0.697	0.699	DIDH_RAT 3-alpha-hydroxysteroid dehydrogenase OS=Rattus norvegicus OX=10116 GN=Akr1c9 PE=1 SV=1
15	D3ZF77	2.19e-169	475	324	0.693	0.691	AK1CA_RAT Aldo-keto reductase family 1 member C15 OS=Rattus norvegicus OX=10116 GN=Akr1c15 PE=1 SV=1
16	Q91X42	1.42e-164	462	323	0.669	0.669	Q91X42_MOUSE Aldo-keto reductase family 1, member C12 OS=Mus musculus OX=10090 GN=Akr1c12 PE=2 SV=1
17	Q9JLI0	1.48e-164	462	323	0.669	0.669	Q9JLI0_MOUSE Aldo-keto reductase a OS=Mus musculus OX=10090 GN=Akr1c12 PE=1 SV=1
18	Q9R0M7	6.28e-164	461	323	0.666	0.666	Q9R0M7_MOUSE Aldo-keto reductase AKR1C12 OS=Mus musculus OX=10090 GN=Akr1c12 PE=2 SV=1
19	Q8VC28	2.36e-160	452	323	0.647	0.647	AK1CD_MOUSE Aldo-keto reductase family 1 member C13 OS=Mus musculus OX=10090 GN=Akr1c13 PE=1 SV=2
20	H0ZPZ0	2.19e-147	419	326	0.604	0.598	H0ZPZ0_TAEGU Aldo-keto reductase family 1 member D1 OS=Taeniopygia guttata OX=59729 GN=AKR1D1 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00248 Aldo_ket_red	3.4e-51	185.6	Aldo/keto reductase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369927

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370254	0.989	Aldo-keto reductase family 1 member C1
2	9606.ENSP00000370129	0.978	Aldo-keto reductase family 1 member C2
3	9606.ENSP00000242375	0.975	3-oxo-5-beta-steroid 4-dehydrogenase
4	9606.ENSP00000274192	0.975	3-oxo-5-alpha-steroid 4-dehydrogenase 1
5	9606.ENSP00000290349	0.970	Carbonyl reductase [NADPH] 1
6	9606.ENSP00000445122	0.970	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
7	9606.ENSP00000358421	0.969	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
8	9606.ENSP00000358903	0.968	Steroid 17-alpha-hydroxylase/17,20 lyase
9	9606.ENSP00000477587	0.967	3-oxo-5-alpha-steroid 4-dehydrogenase 2
10	9606.ENSP00000379683	0.955	Aromatase
11	9606.ENSP00000217961	0.950	Steryl-sulfatase
12	9606.ENSP00000264228	0.950	Polyprenol reductase
13	9606.ENSP00000292427	0.947	Cytochrome P450 11B1, mitochondrial
14	9606.ENSP00000466799	0.947	Estradiol 17-beta-dehydrogenase 1
15	9606.ENSP00000226444	0.945	Estrogen sulfotransferase
16	9606.ENSP00000360687	0.943	Prostaglandin-H2 D-isomerase
17	9606.ENSP00000364412	0.939	Testosterone 17-beta-dehydrogenase 3
18	9606.ENSP00000295256	0.936	Hematopoietic prostaglandin D synthase
19	9606.ENSP00000478561	0.936	Cytochrome P450 1B1
20	9606.ENSP00000451406	0.934	17-beta-hydroxysteroid dehydrogenase type 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004033	0.998	aldo-keto reductase (NADP) activity
GO:0033764	0.997	steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0005488	0.989	binding
GO:0008106	0.979	alcohol dehydrogenase (NADP+) activity
GO:0004032	0.952	alditol:NADP+ 1-oxidoreductase activity
GO:0005515	0.861	protein binding
GO:0097159	0.465	organic cyclic compound binding
GO:1901363	0.417	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006629	0.996	lipid metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0065007	0.976	biological regulation
GO:1901360	0.973	organic cyclic compound metabolic process
GO:0044281	0.948	small molecule metabolic process
GO:0008202	0.932	steroid metabolic process
GO:0050896	0.763	response to stimulus
GO:0042221	0.612	response to chemical
GO:0044255	0.587	cellular lipid metabolic process
GO:0042445	0.532	hormone metabolic process
GO:0032787	0.485	monocarboxylic acid metabolic process
GO:1901576	0.455	organic substance biosynthetic process
GO:0008610	0.453	lipid biosynthetic process
GO:1901615	0.404	organic hydroxy compound metabolic process
GO:0051716	0.391	cellular response to stimulus
GO:0006066	0.386	alcohol metabolic process
GO:0070887	0.372	cellular response to chemical stimulus
GO:0050789	0.368	regulation of biological process
GO:0044249	0.313	cellular biosynthetic process
GO:0050794	0.311	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0070062	0.967	extracellular exosome
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0005634	0.897	nucleus
GO:0016020	0.411	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.-	0.998	With NAD(+) or NADP(+) as acceptor.
RHEA:15937	0.979	a primary alcohol + NADP(+) = an aldehyde + H(+) + NADPH
EC:1.1.1.2	0.979	alcohol dehydrogenase (NADP(+)).
RHEA:12789	0.952	an alditol + NADP(+) = an aldose + H(+) + NADPH
EC:1.1.1.21	0.952	aldose reductase.

[back to server]