StarFunc result for job id P42336

User Input

>input (1068 residues)
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4yknA	0.925	0.821	0.000	1205	0.934	0.827	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
2	PDB:5dxhD	0.900	0.979	0.000	981	0.910	0.991	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
3	PDB:5dxtA	0.818	0.994	0.000	879	0.818	0.994	5dxtA.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
4	PDB:5itdA	0.924	0.991	0.000	995	0.927	0.995	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
5	PDB:5swpA	0.955	0.962	0.000	1060	0.969	0.976	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
6	PDB:8dcxA	0.841	0.963	0.000	930	0.861	0.989	8dcxA.pdb.gz
7	AFDB:F1QAD7	0.977	0.976	0.000	1069	0.917	0.916	F1QAD7.pdb.gz	F1QAD7_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=pik3ca PE=3 SV=2
8	AFDB:O00329	0.868	0.887	7.288E-86	1044	0.394	0.403	O00329.pdb.gz	PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens OX=9606 GN=PIK3CD PE=1 SV=2
9	AFDB:F1NHX1	0.866	0.884	2.669E-85	1046	0.389	0.397	F1NHX1.pdb.gz	F1NHX1_CHICK phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Gallus gallus OX=9031 GN=PIK3CD PE=3 SV=1
10	AFDB:P42338	0.870	0.868	5.332E-85	1070	0.404	0.404	P42338.pdb.gz	PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PIK3CB PE=1 SV=1
11	AFDB:F1RB17	0.851	0.874	4.074E-84	1039	0.392	0.403	F1RB17.pdb.gz
12	PDB:7lq1A	0.823	0.920	5.148E-80	950	0.383	0.431	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
13	PDB:6pyuA	0.808	0.924	2.783E-79	930	0.378	0.434	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
14	AFDB:P91634	0.864	0.849	6.984E-77	1088	0.344	0.337	P91634.pdb.gz	P91634_DROME PI-3 kinase OS=Drosophila melanogaster OX=7227 GN=Pi3K92E PE=1 SV=1
15	AFDB:D4A5Q1	0.791	0.890	8.224E-76	944	0.350	0.396	D4A5Q1.pdb.gz	D4A5Q1_RAT phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Rattus norvegicus OX=10116 GN=Pik3cd PE=3 SV=2
16	PDB:2y3aA	0.815	0.888	4.050E-73	976	0.389	0.425	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.
17	AFDB:F1QVE6	0.765	0.745	3.161E-71	1098	0.337	0.328	F1QVE6.pdb.gz
18	AFDB:A0A024R720	0.765	0.742	5.494E-70	1102	0.331	0.320	A0A024R720.pdb.gz
19	PDB:6gy0A	0.707	0.911	3.734E-69	822	0.334	0.434	6gy0A.pdb.gz	A class of highly selective inhibitors bind to an active state of PI3K gamma.
20	AFDB:P54673	0.733	0.507	3.431E-66	1571	0.314	0.213	P54673.pdb.gz	PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum OX=44689 GN=pikA PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K344	0.0	2205	1068	0.988	0.988	PK3CA_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Rattus norvegicus OX=10116 GN=Pik3ca PE=1 SV=1
2	F1NHX1	0.0	736	1046	0.391	0.400	F1NHX1_CHICK phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Gallus gallus OX=9031 GN=PIK3CD PE=3 SV=1
3	F1QAD7	0.0	2051	1069	0.918	0.917	F1QAD7_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=pik3ca PE=3 SV=2
4	H0Y871	0.0	596	702	0.307	0.467	H0Y871_HUMAN Phosphatidylinositol 3-kinase catalytic subunit type 3 (Fragment) OS=Homo sapiens OX=9606 GN=PIK3CB PE=1 SV=1
5	O00329	0.0	737	1044	0.399	0.408	PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens OX=9606 GN=PIK3CD PE=1 SV=2
6	O35904	0.0	751	1043	0.395	0.405	PK3CD_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Mus musculus OX=10090 GN=Pik3cd PE=1 SV=2
7	O42391	0.0	2163	1068	0.963	0.963	O42391_CHICK phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Gallus gallus OX=9031 GN=PIK3CA PE=1 SV=1
8	P32871	0.0	2224	1068	0.998	0.998	PK3CA_BOVIN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Bos taurus OX=9913 GN=PIK3CA PE=1 SV=1
9	P42336	0.0	2227	1068	1.000	1.000	PK3CA_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PIK3CA PE=1 SV=2
10	P42337	0.0	2204	1068	0.987	0.987	PK3CA_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Mus musculus OX=10090 GN=Pik3ca PE=1 SV=2
11	P42338	0.0	740	1070	0.411	0.410	PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PIK3CB PE=1 SV=1
12	P91634	0.0	620	1088	0.360	0.353	P91634_DROME PI-3 kinase OS=Drosophila melanogaster OX=7227 GN=Pi3K92E PE=1 SV=1
13	Q7SYE7	0.0	721	1039	0.402	0.413	Q7SYE7_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=zgc:63473 PE=2 SV=1
14	Q8BTI9	0.0	745	1064	0.409	0.411	PK3CB_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Mus musculus OX=10090 GN=Pik3cb PE=1 SV=2
15	Q9Z1L0	0.0	743	1070	0.408	0.407	PK3CB_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus OX=10116 GN=Pik3cb PE=2 SV=1
16	Q9JHG7	1.27e-176	548	1102	0.334	0.324	PK3CG_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Mus musculus OX=10090 GN=Pik3cg PE=1 SV=2
17	D3ZFJ0	2.23e-176	547	1102	0.354	0.343	D3ZFJ0_RAT phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Rattus norvegicus OX=10116 GN=Pik3cg PE=1 SV=1
18	P48736	8.37e-176	546	1102	0.335	0.325	PK3CG_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Homo sapiens OX=9606 GN=PIK3CG PE=1 SV=3
19	Q6NTI2	2.25e-164	516	1098	0.326	0.317	Q6NTI2_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=zgc:77033 PE=2 SV=1
20	P54673	7.05e-157	507	1571	0.295	0.201	PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum OX=44689 GN=pikA PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	2.1e+02	12.4	ABC1 atypical kinase-like domain
2	PF00858 ASC	1.9e+02	12.4	Amiloride-sensitive sodium channel
3	PF10083 DUF2321	52	14.9	Uncharacterized protein conserved in bacteria (DUF2321)
4	PF00613 PI3Ka	3.8e-65	230.3	Phosphoinositide 3-kinase family, accessory domain (PIK domain)
5	PF00792 PI3K_C2	1.4e-31	120.7	Phosphoinositide 3-kinase C2
6	PF02192 PI3K_p85B	6.9e-27	104.3	PI3-kinase family, p85-binding domain
7	PF00794 PI3K_rbd	3.4e-35	131.8	PI3-kinase family, ras-binding domain
8	PF00454 PI3_PI4_kinase	4.2e-54	195.6	Phosphatidylinositol 3- and 4-kinase
9	PF00312 Ribosomal_S15	4.2e+02	12.6	Ribosomal protein S15

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000006866

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000004228	0.999	Uncharacterized protein
2	9544.ENSMMUP00000015140	0.999	Phosphatidylinositol 3-kinase regulatory subunit alpha isoform 2
3	9544.ENSMMUP00000016376	0.997	Phosphatidylinositol-4-phosphate 5-kinase, type I, beta
4	9544.ENSMMUP00000039086	0.997	Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha
5	9544.ENSMMUP00000028522	0.996	GTPase HRas isoform 2
6	9544.ENSMMUP00000037491	0.996	Insulin receptor substrate 1
7	9544.ENSMMUP00000040267	0.995	Uncharacterized protein
8	9544.ENSMMUP00000029471	0.991	Epidermal growth factor receptor
9	9544.ENSMMUP00000001399	0.989	Belongs to the protein kinase superfamily.
10	9544.ENSMMUP00000016244	0.989	Phosphatidylinositol-5-phosphate 4-kinase, type II, beta
11	9544.ENSMMUP00000038902	0.989	Phosphatidylinositol-4-phosphate 5-kinase-like 1
12	9544.ENSMMUP00000011055	0.988	Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
13	9544.ENSMMUP00000001803	0.987	Receptor protein-tyrosine kinase
14	9544.ENSMMUP00000002635	0.985	GTPase NRas
15	9544.ENSMMUP00000027321	0.980	Erb-b2 receptor tyrosine kinase 3
16	9544.ENSMMUP00000025391	0.979	Serine/threonine-protein kinase mTOR
17	9544.ENSMMUP00000007641	0.978	Phosphoinositide-3-kinase, regulatory subunit 5
18	9544.ENSMMUP00000016141	0.977	Tyrosine-protein kinase receptor
19	9544.ENSMMUP00000019705	0.977	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
20	9544.ENSMMUP00000028694	0.976	Insulin receptor substrate 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016303	1.000	1-phosphatidylinositol-3-kinase activity
GO:0046934	0.745	phosphatidylinositol-4,5-bisphosphate 3-kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.975	cellular process
GO:0050789	0.974	regulation of biological process
GO:0050896	0.969	response to stimulus
GO:0044237	0.961	cellular metabolic process
GO:0050794	0.900	regulation of cellular process
GO:0046486	0.845	glycerolipid metabolic process
GO:0048519	0.839	negative regulation of biological process
GO:0120035	0.835	regulation of plasma membrane bounded cell projection organization
GO:0046854	0.821	phosphatidylinositol phosphate biosynthetic process
GO:0071840	0.774	cellular component organization or biogenesis
GO:0006950	0.726	response to stress
GO:0065008	0.687	regulation of biological quality
GO:0016043	0.681	cellular component organization
GO:0042221	0.659	response to chemical
GO:0032501	0.629	multicellular organismal process
GO:0048856	0.624	anatomical structure development
GO:0051716	0.581	cellular response to stimulus
GO:0048518	0.581	positive regulation of biological process
GO:0007154	0.568	cell communication
GO:0048017	0.563	inositol lipid-mediated signaling
GO:0048015	0.550	phosphatidylinositol-mediated signaling
GO:0071375	0.536	cellular response to peptide hormone stimulus
GO:0002376	0.533	immune system process
GO:0014065	0.531	phosphatidylinositol 3-kinase signaling
GO:0040008	0.517	regulation of growth
GO:0006996	0.513	organelle organization
GO:0090066	0.511	regulation of anatomical structure size
GO:0048638	0.502	regulation of developmental growth
GO:0008361	0.497	regulation of cell size
GO:0048522	0.490	positive regulation of cellular process
GO:0009605	0.461	response to external stimulus
GO:0001558	0.461	regulation of cell growth
GO:0048583	0.431	regulation of response to stimulus
GO:0023051	0.410	regulation of signaling
GO:0050770	0.402	regulation of axonogenesis
GO:0010646	0.377	regulation of cell communication
GO:0044087	0.368	regulation of cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	0.999	cytoplasm
GO:0032991	0.993	protein-containing complex
GO:0005829	0.992	cytosol
GO:0098796	0.979	membrane protein complex
GO:0005942	0.974	phosphatidylinositol 3-kinase complex
GO:0005886	0.959	plasma membrane
GO:0005943	0.381	phosphatidylinositol 3-kinase complex, class IA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12709	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+)
EC:2.7.1.137	1.000	phosphatidylinositol 3-kinase.
RHEA:21292	0.745	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+)
EC:2.7.1.153	0.745	phosphatidylinositol-4,5-bisphosphate 3-kinase.

[back to server]