StarFunc result for job id P42338

User Input

>input (1070 residues)
MCFSFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDSLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEH
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKE
ILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALGNRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2y3aA	0.875	0.957	0.000	976	0.865	0.949	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.
2	AFDB:F1NHX1	0.926	0.947	0.000	1046	0.568	0.581	F1NHX1.pdb.gz	F1NHX1_CHICK phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Gallus gallus OX=9031 GN=PIK3CD PE=3 SV=1
3	AFDB:F1RB17	0.937	0.965	0.000	1039	0.540	0.556	F1RB17.pdb.gz
4	AFDB:O00329	0.934	0.957	0.000	1044	0.562	0.576	O00329.pdb.gz	PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens OX=9606 GN=PIK3CD PE=1 SV=2
5	AFDB:P42338	1.000	1.000	0.000	1070	1.000	1.000	P42338.pdb.gz	PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PIK3CB PE=1 SV=1
6	PDB:6pyuA	0.836	0.960	3.321E-95	930	0.525	0.604	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
7	AFDB:D4A5Q1	0.837	0.946	1.183E-94	944	0.498	0.565	D4A5Q1.pdb.gz	D4A5Q1_RAT phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Rattus norvegicus OX=10116 GN=Pik3cd PE=3 SV=2
8	PDB:7lq1A	0.847	0.952	2.305E-94	950	0.536	0.603	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
9	AFDB:F1QAD7	0.888	0.889	2.894E-84	1069	0.398	0.399	F1QAD7.pdb.gz	F1QAD7_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=pik3ca PE=3 SV=2
10	AFDB:P91634	0.905	0.891	5.218E-84	1088	0.369	0.363	P91634.pdb.gz	P91634_DROME PI-3 kinase OS=Drosophila melanogaster OX=7227 GN=Pi3K92E PE=1 SV=1
11	PDB:6gy0A	0.739	0.957	4.434E-80	822	0.468	0.609	6gy0A.pdb.gz	A class of highly selective inhibitors bind to an active state of PI3K gamma.
12	PDB:4yknA	0.838	0.747	2.227E-78	1205	0.389	0.345	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
13	PDB:5dxhD	0.822	0.894	9.723E-78	981	0.381	0.416	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
14	PDB:4ajwB	0.713	0.959	1.989E-77	792	0.451	0.610	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
15	PDB:5itdA	0.825	0.885	1.072E-76	995	0.398	0.428	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
16	PDB:5swpA	0.847	0.855	9.185E-76	1060	0.393	0.396	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
17	PDB:4ajwA	0.683	0.948	2.983E-72	765	0.437	0.612	4ajwA.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
18	AFDB:P54673	0.763	0.525	3.455E-71	1571	0.341	0.232	P54673.pdb.gz	PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum OX=44689 GN=pikA PE=2 SV=2
19	AFDB:F1QVE6	0.777	0.758	1.509E-70	1098	0.327	0.319	F1QVE6.pdb.gz
20	AFDB:A0A024R720	0.779	0.757	2.082E-68	1102	0.317	0.308	A0A024R720.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K344	0.0	738	1068	0.411	0.412	PK3CA_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Rattus norvegicus OX=10116 GN=Pik3ca PE=1 SV=1
2	D4A5Q1	0.0	1036	944	0.500	0.567	D4A5Q1_RAT phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Rattus norvegicus OX=10116 GN=Pik3cd PE=3 SV=2
3	F1NHX1	0.0	1234	1046	0.570	0.583	F1NHX1_CHICK phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Gallus gallus OX=9031 GN=PIK3CD PE=3 SV=1
4	F1QAD7	0.0	749	1069	0.407	0.408	F1QAD7_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=pik3ca PE=3 SV=2
5	H0Y871	0.0	1446	702	0.655	0.999	H0Y871_HUMAN Phosphatidylinositol 3-kinase catalytic subunit type 3 (Fragment) OS=Homo sapiens OX=9606 GN=PIK3CB PE=1 SV=1
6	O00329	0.0	1186	1044	0.565	0.580	PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens OX=9606 GN=PIK3CD PE=1 SV=2
7	O35904	0.0	1188	1043	0.551	0.566	PK3CD_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Mus musculus OX=10090 GN=Pik3cd PE=1 SV=2
8	O42391	0.0	737	1068	0.407	0.407	O42391_CHICK phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Gallus gallus OX=9031 GN=PIK3CA PE=1 SV=1
9	P32871	0.0	738	1068	0.411	0.412	PK3CA_BOVIN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Bos taurus OX=9913 GN=PIK3CA PE=1 SV=1
10	P42336	0.0	738	1068	0.412	0.413	PK3CA_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PIK3CA PE=1 SV=2
11	P42337	0.0	737	1068	0.410	0.411	PK3CA_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Mus musculus OX=10090 GN=Pik3ca PE=1 SV=2
12	P42338	0.0	2223	1070	1.000	1.000	PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PIK3CB PE=1 SV=1
13	P91634	0.0	708	1088	0.379	0.373	P91634_DROME PI-3 kinase OS=Drosophila melanogaster OX=7227 GN=Pi3K92E PE=1 SV=1
14	Q7SYE7	0.0	1160	1039	0.546	0.562	Q7SYE7_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=zgc:63473 PE=2 SV=1
15	Q8BTI9	0.0	2108	1064	0.953	0.959	PK3CB_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Mus musculus OX=10090 GN=Pik3cb PE=1 SV=2
16	Q9Z1L0	0.0	2103	1070	0.959	0.959	PK3CB_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus OX=10116 GN=Pik3cb PE=2 SV=1
17	P54673	1.33e-168	538	1571	0.335	0.228	PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum OX=44689 GN=pikA PE=2 SV=2
18	Q6NTI2	4.42e-166	520	1098	0.346	0.337	Q6NTI2_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=zgc:77033 PE=2 SV=1
19	Q9JHG7	2.70e-164	515	1102	0.317	0.308	PK3CG_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Mus musculus OX=10090 GN=Pik3cg PE=1 SV=2
20	D3ZFJ0	5.85e-163	512	1102	0.319	0.309	D3ZFJ0_RAT phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Rattus norvegicus OX=10116 GN=Pik3cg PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00613 PI3Ka	6.2e-60	213.3	Phosphoinositide 3-kinase family, accessory domain (PIK domain)
2	PF00792 PI3K_C2	5.6e-16	70.2	Phosphoinositide 3-kinase C2
3	PF02192 PI3K_p85B	7.8e-27	104.1	PI3-kinase family, p85-binding domain
4	PF00794 PI3K_rbd	5.5e-31	118.3	PI3-kinase family, ras-binding domain
5	PF00454 PI3_PI4_kinase	4.2e-58	208.7	Phosphatidylinositol 3- and 4-kinase
6	PF05773 RWD	4.5e+02	12.5	RWD domain
7	PF11801 Tom37_C	37	15.7	Tom37 C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289153

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222254	0.999	Phosphatidylinositol 3-kinase regulatory subunit beta
2	9606.ENSP00000428056	0.999	Phosphatidylinositol 3-kinase regulatory subunit alpha
3	9606.ENSP00000262741	0.998	Phosphatidylinositol 3-kinase regulatory subunit gamma
4	9606.ENSP00000361021	0.993	Phosphatase and tensin homolog
5	9606.ENSP00000383118	0.993	Cell division control protein 42 homolog
6	9606.ENSP00000451828	0.993	RAC-alpha serine/threonine-protein kinase
7	9606.ENSP00000273047	0.992	Ras-related protein Rab-5A
8	9606.ENSP00000304895	0.984	Insulin receptor substrate 1
9	9606.ENSP00000407586	0.971	GTPase HRas
10	9606.ENSP00000376345	0.967	Growth factor receptor-bound protein 2
11	9606.ENSP00000275493	0.966	Epidermal growth factor receptor
12	9606.ENSP00000365016	0.966	Insulin receptor substrate 2
13	9606.ENSP00000269571	0.965	Receptor tyrosine-protein kinase erbB-2
14	9606.ENSP00000480157	0.965	Phosphoinositide 3-kinase regulatory subunit 6
15	9606.ENSP00000392812	0.963	Phosphoinositide 3-kinase regulatory subunit 5
16	9606.ENSP00000256078	0.961	GTPase KRas
17	9606.ENSP00000267101	0.959	Receptor tyrosine-protein kinase erbB-3
18	9606.ENSP00000362680	0.956	Proto-oncogene tyrosine-protein kinase Src
19	9606.ENSP00000444986	0.956	Tyrosine-protein kinase HCK
20	9606.ENSP00000375892	0.951	RAC-beta serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016303	0.999	1-phosphatidylinositol-3-kinase activity
GO:0140096	0.674	catalytic activity, acting on a protein
GO:0004672	0.560	protein kinase activity
GO:0046934	0.403	phosphatidylinositol-4,5-bisphosphate 3-kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0006661	0.988	phosphatidylinositol biosynthetic process
GO:0051716	0.986	cellular response to stimulus
GO:0048583	0.986	regulation of response to stimulus
GO:0007154	0.985	cell communication
GO:0048522	0.985	positive regulation of cellular process
GO:0007165	0.983	signal transduction
GO:0046854	0.982	phosphatidylinositol phosphate biosynthetic process
GO:0009966	0.969	regulation of signal transduction
GO:0032501	0.957	multicellular organismal process
GO:1902531	0.948	regulation of intracellular signal transduction
GO:0035556	0.939	intracellular signal transduction
GO:0006950	0.936	response to stress
GO:0051239	0.932	regulation of multicellular organismal process
GO:0048584	0.932	positive regulation of response to stimulus
GO:0065008	0.931	regulation of biological quality
GO:0019222	0.923	regulation of metabolic process
GO:0048519	0.920	negative regulation of biological process
GO:1902533	0.908	positive regulation of intracellular signal transduction
GO:0040012	0.797	regulation of locomotion
GO:0060255	0.774	regulation of macromolecule metabolic process
GO:0030334	0.771	regulation of cell migration
GO:0048017	0.761	inositol lipid-mediated signaling
GO:0042060	0.749	wound healing
GO:0031323	0.737	regulation of cellular metabolic process
GO:0010632	0.705	regulation of epithelial cell migration
GO:0030168	0.699	platelet activation
GO:0010594	0.677	regulation of endothelial cell migration
GO:0030335	0.660	positive regulation of cell migration
GO:0080090	0.657	regulation of primary metabolic process
GO:0051896	0.653	regulation of protein kinase B signaling
GO:0048523	0.595	negative regulation of cellular process
GO:0048015	0.594	phosphatidylinositol-mediated signaling
GO:0065009	0.592	regulation of molecular function
GO:0051056	0.588	regulation of small GTPase mediated signal transduction
GO:0051171	0.560	regulation of nitrogen compound metabolic process
GO:0010634	0.555	positive regulation of epithelial cell migration
GO:0046578	0.533	regulation of Ras protein signal transduction
GO:0007166	0.533	cell surface receptor signaling pathway
GO:0051246	0.513	regulation of protein metabolic process
GO:0050790	0.490	regulation of catalytic activity
GO:0007169	0.490	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0035020	0.484	regulation of Rac protein signal transduction
GO:0042221	0.466	response to chemical
GO:0030155	0.463	regulation of cell adhesion
GO:0009893	0.455	positive regulation of metabolic process
GO:0031325	0.440	positive regulation of cellular metabolic process
GO:0006807	0.427	nitrogen compound metabolic process
GO:0010595	0.419	positive regulation of endothelial cell migration
GO:0010604	0.417	positive regulation of macromolecule metabolic process
GO:0010941	0.405	regulation of cell death
GO:0071840	0.403	cellular component organization or biogenesis
GO:0010468	0.399	regulation of gene expression
GO:0042981	0.398	regulation of apoptotic process
GO:0032502	0.393	developmental process
GO:0016310	0.377	phosphorylation
GO:0042325	0.366	regulation of phosphorylation
GO:0048856	0.355	anatomical structure development
GO:0051173	0.355	positive regulation of nitrogen compound metabolic process
GO:1901564	0.346	organonitrogen compound metabolic process
GO:0031399	0.338	regulation of protein modification process
GO:0044093	0.330	positive regulation of molecular function
GO:0048585	0.323	negative regulation of response to stimulus
GO:0050793	0.321	regulation of developmental process
GO:0043170	0.321	macromolecule metabolic process
GO:0051128	0.321	regulation of cellular component organization
GO:0014065	0.321	phosphatidylinositol 3-kinase signaling
GO:0070887	0.311	cellular response to chemical stimulus
GO:0016043	0.310	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0098796	0.987	membrane protein complex
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:1902494	0.985	catalytic complex
GO:0070013	0.980	intracellular organelle lumen
GO:0005942	0.976	phosphatidylinositol 3-kinase complex
GO:0031981	0.972	nuclear lumen
GO:0071944	0.933	cell periphery
GO:0005886	0.914	plasma membrane
GO:0005654	0.691	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12709	0.999	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+)
EC:2.7.1.137	0.999	phosphatidylinositol 3-kinase.
RHEA:21292	0.403	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+)
EC:2.7.1.153	0.403	phosphatidylinositol-4,5-bisphosphate 3-kinase.

[back to server]