StarFunc result for job id P42345

User Input

>input (2549 residues)
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5h64A	0.578	0.688	0.000	2101	0.809	0.981	5h64A.pdb.gz
2	PDB:6bcuA	0.852	0.984	0.000	2204	0.843	0.975	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
3	PDB:6zwmB	0.750	0.865	0.000	2185	0.852	0.994	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
4	PDB:7owgB	0.697	0.810	0.000	2152	0.821	0.973	7owgB.pdb.gz
5	AFDB:A0A1D8PHX3	0.848	0.870	0.000	2482	0.416	0.427	A0A1D8PHX3.pdb.gz	A0A1D8PHX3_CANAL Serine/threonine-protein kinase TOR OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TOR1 PE=3 SV=1
6	AFDB:B0UX67	0.960	0.955	0.000	2563	0.895	0.890	B0UX67.pdb.gz
7	AFDB:O14356	0.852	0.928	0.000	2335	0.421	0.459	O14356.pdb.gz	TOR1_SCHPO Serine/threonine-protein kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tor1 PE=1 SV=1
8	AFDB:P32600	0.864	0.889	0.000	2474	0.410	0.422	P32600.pdb.gz	TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOR2 PE=1 SV=3
9	AFDB:P35169	0.557	0.574	0.000	2470	0.390	0.402	P35169.pdb.gz	TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOR1 PE=1 SV=3
10	AFDB:P42345	1.000	1.000	0.000	2549	1.000	1.000	P42345.pdb.gz	MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1
11	AFDB:Q38AC2	0.795	0.831	0.000	2432	0.271	0.285	Q38AC2.pdb.gz	Q38AC2_TRYB2 Serine/threonine-protein kinase TOR OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2060 PE=3 SV=1
12	AFDB:Q86C65	0.864	0.924	0.000	2380	0.489	0.524	Q86C65.pdb.gz	TOR_DICDI Serine/threonine-protein kinase tor OS=Dictyostelium discoideum OX=44689 GN=tor PE=1 SV=1
13	AFDB:Q95Q95	0.845	0.801	0.000	2697	0.371	0.350	Q95Q95.pdb.gz	TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans OX=6239 GN=let-363 PE=2 SV=3
14	AFDB:Q9FR53	0.829	0.851	0.000	2481	0.413	0.425	Q9FR53.pdb.gz	TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana OX=3702 GN=TOR PE=1 SV=1
15	PDB:6emkA	0.599	0.662	1.559E-60	2262	0.381	0.429	6emkA.pdb.gz
16	PDB:7ni5A	0.395	0.364	1.243E-44	2791	0.165	0.151	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
17	PDB:7sicA	0.386	0.358	1.665E-43	2773	0.166	0.153	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
18	PDB:7su3A	0.374	0.258	1.439E-39	3802	0.157	0.105	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
19	PDB:7tyrA	0.370	0.249	1.998E-38	3905	0.159	0.104	7tyrA.pdb.gz
20	PDB:7pw9A	0.367	0.469	4.368E-38	1952	0.137	0.179	7pw9A.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PHX3	1797	2482	0.388	0.398	A0A1D8PHX3_CANAL Serine/threonine-protein kinase TOR OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TOR1 PE=3 SV=1
2	B3KX59	1582	754	0.295	0.999	B3KX59_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 PE=2 SV=1
3	B4E2H2	3442	1728	0.654	0.964	B4E2H2_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 PE=2 SV=1
4	C8V3B2	1934	2385	0.406	0.434	C8V3B2_EMENI non-specific serine/threonine protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05982 PE=3 SV=1
5	O14356	1014	2335	0.228	0.249	TOR1_SCHPO Serine/threonine-protein kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tor1 PE=1 SV=1
6	O76222	747	1583	0.208	0.335	O76222_9TRYP non-specific serine/threonine protein kinase (Fragment) OS=Trypanosoma brucei OX=5691 GN=PI3K PE=1 SV=1
7	P32600	1713	2474	0.381	0.393	TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOR2 PE=1 SV=3
8	P35169	1687	2470	0.365	0.377	TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOR1 PE=1 SV=3
9	P42345	5307	2549	1.000	1.000	MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1
10	P42346	5257	2549	0.989	0.989	MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus OX=10116 GN=Mtor PE=1 SV=1
11	Q06RG6	4694	2515	0.896	0.908	Q06RG6_DANRE Serine/threonine-protein kinase TOR OS=Danio rerio OX=7955 GN=tor PE=1 SV=2
12	Q38AC2	866	2432	0.259	0.271	Q38AC2_TRYB2 Serine/threonine-protein kinase TOR OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2060 PE=3 SV=1
13	Q86C65	1286	2380	0.280	0.300	TOR_DICDI Serine/threonine-protein kinase tor OS=Dictyostelium discoideum OX=44689 GN=tor PE=1 SV=1
14	Q8T9I6	662	455	0.126	0.705	Q8T9I6_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=mTor PE=2 SV=1
15	Q95Q95	1502	2697	0.382	0.361	TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans OX=6239 GN=let-363 PE=2 SV=3
16	Q96QW8	1887	895	0.351	1.000	Q96QW8_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=FRAP1 PE=3 SV=1
17	Q9FR53	800	2481	0.158	0.162	TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana OX=3702 GN=TOR PE=1 SV=1
18	Q9JLN9	5255	2549	0.989	0.989	MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus OX=10090 GN=Mtor PE=1 SV=2
19	Q9VK45	2679	2470	0.543	0.560	TOR_DROME Serine/threonine-protein kinase mTor OS=Drosophila melanogaster OX=7227 GN=mTor PE=1 SV=1
20	Q9Y7K2	1876	2337	0.400	0.436	TOR2_SCHPO Serine/threonine-protein kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tor2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11865 DUF3385	8.8e-56	199.8	Domain of unknown function (DUF3385)
2	PF00275 EPSP_synthase	1.7e+02	12.3	EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)
3	PF02259 FAT	7.3e-127	435.0	FAT domain
4	PF02260 FATC	4.2e-14	63.3	FATC domain
5	PF08771 FRB_dom	2.8e-42	154.4	FKBP12-rapamycin binding domain
6	PF02985 HEAT	3.5	19.1	HEAT repeat
7	PF13646 HEAT_2	3.3e-06	38.7	HEAT repeats
8	PF13513 HEAT_EZ	3.2e+02	13.3	HEAT-like repeat
9	PF05004 IFRD	0.044	24.4	Interferon-related developmental regulator (IFRD)
10	PF00454 PI3_PI4_kinase	6.9e-73	257.1	Phosphatidylinositol 3- and 4-kinase
11	PF14559 TPR_19	31	16.4	Tetratricopeptide repeat
12	PF08064 UME	6.4	18.1	UME (NUC010) domain
13	PF03224 V-ATPase_H_N	18	16.1	V-ATPase subunit H

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354558

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219476	0.999	Tuberin
2	9606.ENSP00000225577	0.999	Ribosomal protein S6 kinase beta-1
3	9606.ENSP00000262187	0.999	GTP-binding protein Rheb
4	9606.ENSP00000265960	0.999	Target of rapamycin complex 2 subunit MAPKAP1
5	9606.ENSP00000286234	0.999	DEP domain-containing mTOR-interacting protein
6	9606.ENSP00000296782	0.999	Rapamycin-insensitive companion of mTOR
7	9606.ENSP00000307272	0.999	Regulatory-associated protein of mTOR
8	9606.ENSP00000324560	0.999	Serine/threonine-protein kinase ULK1
9	9606.ENSP00000340691	0.999	Eukaryotic translation initiation factor 4E-binding protein 1
10	9606.ENSP00000362092	0.999	Ras-related GTP-binding protein C
11	9606.ENSP00000369899	0.999	Ras-related GTP-binding protein A
12	9606.ENSP00000375711	0.999	Proline-rich AKT1 substrate 1
13	9606.ENSP00000383003	0.999	Peptidyl-prolyl cis-trans isomerase FKBP1A
14	9606.ENSP00000425561	0.999	Eukaryotic translation initiation factor 4E
15	9606.ENSP00000451828	0.999	RAC-alpha serine/threonine-protein kinase
16	9606.ENSP00000456405	0.999	Target of rapamycin complex subunit LST8
17	9606.ENSP00000357288	0.997	Ragulator complex protein LAMTOR2
18	9606.ENSP00000362547	0.997	TELO2-interacting protein 1 homolog
19	9606.ENSP00000432412	0.997	Autophagy-related protein 13
20	9606.ENSP00000262850	0.996	Ras-related GTP-binding protein B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0097159	0.944	organic cyclic compound binding
GO:1901363	0.937	heterocyclic compound binding
GO:0003677	0.927	DNA binding
GO:0043565	0.904	sequence-specific DNA binding
GO:0003690	0.898	double-stranded DNA binding
GO:1990837	0.888	sequence-specific double-stranded DNA binding
GO:0000976	0.869	transcription cis-regulatory region binding
GO:0008134	0.860	transcription factor binding
GO:0000182	0.799	rDNA binding
GO:0140296	0.793	general transcription initiation factor binding
GO:0001016	0.791	RNA polymerase III transcription regulatory region sequence-specific DNA binding
GO:0042802	0.564	identical protein binding
GO:0000992	0.525	RNA polymerase III cis-regulatory region sequence-specific DNA binding
GO:0001025	0.491	RNA polymerase III general transcription initiation factor binding
GO:0001006	0.491	RNA polymerase III type 3 promoter sequence-specific DNA binding
GO:0001003	0.491	RNA polymerase III type 2 promoter sequence-specific DNA binding
GO:0001002	0.491	RNA polymerase III type 1 promoter sequence-specific DNA binding
GO:0051219	0.461	phosphoprotein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0051960	0.994	regulation of nervous system development
GO:0032501	0.990	multicellular organismal process
GO:0048522	0.989	positive regulation of cellular process
GO:0048513	0.987	animal organ development
GO:0031644	0.985	regulation of nervous system process
GO:0009987	0.982	cellular process
GO:0031641	0.976	regulation of myelination
GO:0009966	0.975	regulation of signal transduction
GO:0050896	0.973	response to stimulus
GO:0031646	0.970	positive regulation of nervous system process
GO:0032006	0.967	regulation of TOR signaling
GO:0019222	0.966	regulation of metabolic process
GO:0007275	0.955	multicellular organism development
GO:0048731	0.943	system development
GO:0060255	0.929	regulation of macromolecule metabolic process
GO:0031323	0.929	regulation of cellular metabolic process
GO:0051171	0.899	regulation of nitrogen compound metabolic process
GO:0043588	0.898	skin development
GO:0080090	0.896	regulation of primary metabolic process
GO:0048519	0.844	negative regulation of biological process
GO:0055123	0.840	digestive system development
GO:0051716	0.812	cellular response to stimulus
GO:0009893	0.788	positive regulation of metabolic process
GO:0048523	0.772	negative regulation of cellular process
GO:0008152	0.765	metabolic process
GO:0035295	0.754	tube development
GO:0010604	0.727	positive regulation of macromolecule metabolic process
GO:0031325	0.721	positive regulation of cellular metabolic process
GO:0051173	0.712	positive regulation of nitrogen compound metabolic process
GO:0071704	0.705	organic substance metabolic process
GO:0044237	0.694	cellular metabolic process
GO:0048565	0.692	digestive tract development
GO:0007154	0.685	cell communication
GO:0042221	0.657	response to chemical
GO:0071840	0.635	cellular component organization or biogenesis
GO:0044238	0.631	primary metabolic process
GO:0051246	0.628	regulation of protein metabolic process
GO:0016043	0.604	cellular component organization
GO:0009892	0.584	negative regulation of metabolic process
GO:0006807	0.582	nitrogen compound metabolic process
GO:0031324	0.573	negative regulation of cellular metabolic process
GO:0019219	0.570	regulation of nucleobase-containing compound metabolic process
GO:0023052	0.565	signaling
GO:0051247	0.553	positive regulation of protein metabolic process
GO:0007165	0.548	signal transduction
GO:0051128	0.538	regulation of cellular component organization
GO:0043170	0.524	macromolecule metabolic process
GO:0010468	0.510	regulation of gene expression
GO:0031326	0.506	regulation of cellular biosynthetic process
GO:0010556	0.489	regulation of macromolecule biosynthetic process
GO:0009894	0.452	regulation of catabolic process
GO:0051252	0.435	regulation of RNA metabolic process
GO:0048584	0.430	positive regulation of response to stimulus
GO:1901564	0.425	organonitrogen compound metabolic process
GO:0065009	0.424	regulation of molecular function
GO:0019220	0.423	regulation of phosphate metabolic process
GO:0031399	0.415	regulation of protein modification process
GO:0019538	0.414	protein metabolic process
GO:0006950	0.405	response to stress
GO:0035556	0.394	intracellular signal transduction
GO:0031329	0.390	regulation of cellular catabolic process
GO:0070887	0.361	cellular response to chemical stimulus
GO:0010557	0.351	positive regulation of macromolecule biosynthetic process
GO:0050790	0.349	regulation of catalytic activity
GO:0031328	0.343	positive regulation of cellular biosynthetic process
GO:0043412	0.341	macromolecule modification
GO:0006355	0.341	regulation of DNA-templated transcription
GO:0036211	0.334	protein modification process
GO:0006796	0.333	phosphate-containing compound metabolic process
GO:0010506	0.332	regulation of autophagy
GO:0044093	0.328	positive regulation of molecular function
GO:0045935	0.325	positive regulation of nucleobase-containing compound metabolic process
GO:0042325	0.321	regulation of phosphorylation
GO:0010033	0.315	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0005654	0.997	nucleoplasm
GO:0038201	0.988	TOR complex
GO:0031931	0.973	TORC1 complex
GO:0012505	0.965	endomembrane system
GO:0031090	0.931	organelle membrane
GO:0031982	0.878	vesicle
GO:0098588	0.867	bounding membrane of organelle
GO:0098852	0.766	lytic vacuole membrane
GO:0031410	0.690	cytoplasmic vesicle
GO:0005765	0.607	lysosomal membrane
GO:0042995	0.543	cell projection
GO:0031932	0.508	TORC2 complex
GO:0120025	0.495	plasma membrane bounded cell projection
GO:0005886	0.404	plasma membrane
GO:0043005	0.370	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]