StarFunc result for job id P42566

User Input

>input (896 residues)
MAAAAQLSLTQLSSGNPVYEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLA
DTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAEL
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGML
DRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKYDEIFLKTDKDMD
GFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPP
HVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKE
DTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCA
EEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQ
HLQDSQQEISSMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDYCSLSTSSSETANLN
EHVEGQSNLESEPIHQESPARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDP
FNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFR
QSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESF
GGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTR
PCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADP
SNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42566	1.000	1.000	0.000	896	1.000	1.000	P42566.pdb.gz	EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2
2	AFDB:A7BFV9	0.460	0.460	5.963E-94	897	0.898	0.897	A7BFV9.pdb.gz	A7BFV9_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
3	AFDB:B1AUU8	0.238	0.279	2.764E-86	762	0.850	1.000	B1AUU8.pdb.gz	B1AUU8_HUMAN Epidermal growth factor receptor pathway substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=1
4	AFDB:Q60902	0.207	0.205	1.414E-55	907	0.488	0.482	Q60902.pdb.gz	EP15R_MOUSE Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus OX=10090 GN=Eps15l1 PE=1 SV=3
5	AFDB:Q9HGL2	0.125	0.105	1.447E-21	1116	0.212	0.170	Q9HGL2.pdb.gz	YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC800.10c PE=4 SV=1
6	PDB:4cidA	0.106	0.191	3.437E-7	497	0.069	0.125	4cidA.pdb.gz	Structural Insights Into Membrane Interaction and Caveolar Targeting of Dynamin-Like Ehd2.
7	AFDB:Q10172	0.114	0.059	7.843E-7	1794	0.166	0.083	Q10172.pdb.gz	PAN1_SCHPO Actin cytoskeleton-regulatory complex protein pan1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pan1 PE=1 SV=1
8	AFDB:F4HY32	0.121	0.091	1.058E-5	1247	0.161	0.115	F4HY32.pdb.gz	F4HY32_ARATH Calcium-binding EF hand family protein OS=Arabidopsis thaliana OX=3702 GN=ATEH2 PE=1 SV=1
9	PDB:7soxA	0.100	0.172	2.480E-4	514	0.055	0.095	7soxA.pdb.gz
10	PDB:1v1fA	0.073	0.292	1.908E-3	188	0.040	0.191	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
11	PDB:1a2xA	0.075	0.344	2.463E-3	158	0.038	0.215	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
12	PDB:2zfdA	0.069	0.274	2.592E-3	183	0.044	0.213	2zfdA.pdb.gz	The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
13	PDB:3qrxA	0.078	0.339	2.727E-3	145	0.032	0.200	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
14	PDB:5a2hA	0.082	0.349	2.727E-3	147	0.030	0.184	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
15	PDB:2f2pA	0.081	0.319	3.178E-3	169	0.030	0.160	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
16	PDB:1ggzA	0.088	0.354	3.520E-3	144	0.033	0.208	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
17	PDB:7eebI	0.083	0.372	3.898E-3	174	0.031	0.161	7eebI.pdb.gz	Structure of a mammalian sperm cation channel complex.
18	AFDB:O95819	0.100	0.079	1.200E-1	1239	0.135	0.098	O95819.pdb.gz	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2
19	AFDB:Q6DCV2	0.101	0.110	1.329E-1	817	0.121	0.132	Q6DCV2.pdb.gz	Q6DCV2_XENLA DAZ interacting zinc finger protein 1 L homeolog OS=Xenopus laevis OX=8355 GN=dzip1.L PE=2 SV=1
20	AFDB:A0A0R4IEP9	0.097	0.071	1.398E-1	1332	0.126	0.085	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5YC99	0.0	1524	897	0.897	0.896	A0A8I5YC99_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
2	A0A8I6ALY1	0.0	1364	847	0.828	0.876	A0A8I6ALY1_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
3	A0A8I6GAG1	0.0	579	764	0.431	0.505	A0A8I6GAG1_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
4	A7BFV9	0.0	1524	897	0.898	0.897	A7BFV9_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
5	B1AUU8	0.0	743	762	0.488	0.573	B1AUU8_HUMAN Epidermal growth factor receptor pathway substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=1
6	E9PSY8	0.0	1469	873	0.869	0.892	E9PSY8_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=3
7	P42566	0.0	1822	896	1.000	1.000	EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2
8	P42567	0.0	1491	897	0.894	0.893	EPS15_MOUSE Epidermal growth factor receptor substrate 15 OS=Mus musculus OX=10090 GN=Eps15 PE=1 SV=1
9	Q5JC29	0.0	1343	792	0.771	0.872	Q5JC29_RAT Epidermal growth factor receptor pathway substrate 15 isoform B OS=Rattus norvegicus OX=10116 GN=Eps15 PE=2 SV=1
10	Q60902	0.0	694	907	0.481	0.475	EP15R_MOUSE Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus OX=10090 GN=Eps15l1 PE=1 SV=3
11	Q9UBC2	0.0	667	864	0.465	0.483	EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1
12	Q8WQ61	2.67e-51	198	1253	0.172	0.123	Q8WQ61_DROME Eps-15 protein OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=2 SV=1
13	Q9W111	3.81e-51	197	1253	0.172	0.123	Q9W111_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform A OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=2
14	E3CTP7	9.29e-50	191	792	0.172	0.194	E3CTP7_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform D OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
15	Q8MMD2	4.78e-49	191	1232	0.172	0.125	Q8MMD2_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform B OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
16	Q8MMD3	8.36e-49	190	1106	0.172	0.139	Q8MMD3_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform C OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
17	Q9BIF4	3.06e-38	155	796	0.110	0.124	Q9BIF4_CAEEL EHS-1 OS=Caenorhabditis elegans OX=6239 GN=ehs-1 PE=1 SV=1
18	Q54KI4	3.85e-36	150	1196	0.106	0.079	EPS15_DICDI Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum OX=44689 GN=eps15 PE=1 SV=1
19	Q9HGL2	1.61e-34	145	1116	0.105	0.084	YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC800.10c PE=4 SV=1
20	P34216	3.39e-34	144	1381	0.109	0.071	EDE1_YEAST EH domain-containing and endocytosis protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EDE1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	43	14.3	AAA domain
2	PF08614 ATG16	9.3	17.9	Autophagy protein 16 (ATG16)
3	PF19220 Crescentin	12	16.5	Crescentin protein
4	PF19717 DUF6212	1.3e+02	12.9	Family of unknown function (DUF6212)
5	PF00036 EF-hand_1	1.3e-08	44.9	EF hand
6	PF12763 EF-hand_4	9.2e-39	143.0	Cytoskeletal-regulatory complex EF hand
7	PF13202 EF-hand_5	0.15	22.8	EF hand
8	PF13405 EF-hand_6	5.4e-06	36.8	EF-hand domain
9	PF13499 EF-hand_7	0.018	26.8	EF-hand domain pair
10	PF13833 EF-hand_8	0.59	21.3	EF-hand domain pair
11	PF06160 EzrA	2.4e+02	11.3	Septation ring formation regulator, EzrA
12	PF08702 Fib_alpha	4.9e+02	12.3	Fibrinogen alpha/beta chain family
13	PF09486 HrpB7	15	17.5	Bacterial type III secretion protein (HrpB7)
14	PF12329 TMF_DNA_bd	33	15.9	TATA element modulatory factor 1 DNA binding
15	PF06785 UPF0242	44	15.6	Uncharacterised protein family (UPF0242) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360798

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
2	9606.ENSP00000406209	0.999	Epsin-1
3	9606.ENSP00000450857	0.999	Stonin-2
4	9606.ENSP00000331201	0.998	Hepatocyte growth factor-regulated tyrosine kinase substrate
5	9606.ENSP00000351926	0.998	AP-2 complex subunit alpha-1
6	9606.ENSP00000473001	0.997	F-BAR domain only protein 1
7	9606.ENSP00000393776	0.995	F-BAR domain only protein 2
8	9606.ENSP00000451300	0.993	Protein numb homolog
9	9606.ENSP00000282561	0.992	Gap junction alpha-1 protein
10	9606.ENSP00000377015	0.991	Phosphatidylinositol-binding clathrin assembly protein
11	9606.ENSP00000320543	0.990	Epsin-2
12	9606.ENSP00000292807	0.986	AP-2 complex subunit mu
13	9606.ENSP00000365576	0.986	Ubiquilin-1
14	9606.ENSP00000376345	0.986	Growth factor receptor-bound protein 2
15	9606.ENSP00000327694	0.984	AP-2 complex subunit alpha-2
16	9606.ENSP00000360076	0.984	SH3-containing GRB2-like protein 3-interacting protein 1
17	9606.ENSP00000409667	0.983	Synaptojanin-1
18	9606.ENSP00000362014	0.982	Dynamin-1
19	9606.ENSP00000370719	0.982	Intersectin-1
20	9606.ENSP00000363667	0.981	Tyrosine-protein phosphatase non-receptor type 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0045296	0.722	cadherin binding
GO:0031593	0.628	polyubiquitin modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0032456	0.975	endocytic recycling
GO:0048522	0.958	positive regulation of cellular process
GO:0060255	0.954	regulation of macromolecule metabolic process
GO:0006898	0.949	receptor-mediated endocytosis
GO:0023051	0.947	regulation of signaling
GO:0031323	0.946	regulation of cellular metabolic process
GO:0009893	0.941	positive regulation of metabolic process
GO:0031325	0.919	positive regulation of cellular metabolic process
GO:0065008	0.887	regulation of biological quality
GO:0031623	0.871	receptor internalization
GO:0099003	0.850	vesicle-mediated transport in synapse
GO:0042127	0.765	regulation of cell population proliferation
GO:0031503	0.719	protein-containing complex localization
GO:0099072	0.714	regulation of postsynaptic membrane neurotransmitter receptor levels
GO:0010604	0.714	positive regulation of macromolecule metabolic process
GO:0071840	0.685	cellular component organization or biogenesis
GO:0016043	0.656	cellular component organization
GO:0006996	0.452	organelle organization
GO:0023056	0.449	positive regulation of signaling
GO:0050896	0.326	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031982	0.997	vesicle
GO:0098590	0.996	plasma membrane region
GO:0005768	0.989	endosome
GO:0030054	0.957	cell junction
GO:0045177	0.763	apical part of cell
GO:0005769	0.749	early endosome
GO:0045178	0.706	basal part of cell
GO:0009925	0.670	basal plasma membrane
GO:0016324	0.653	apical plasma membrane
GO:0005634	0.653	nucleus
GO:0045202	0.640	synapse
GO:0098978	0.632	glutamatergic synapse
GO:0032991	0.380	protein-containing complex
GO:0070013	0.367	intracellular organelle lumen
GO:0016235	0.304	aggresome
GO:0005654	0.304	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]