StarFunc result for job id P42574

User Input

>input (277 residues)
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42574	1.000	1.000	8.381E-60	277	1.000	1.000	P42574.pdb.gz	CASP3_HUMAN Caspase-3 OS=Homo sapiens OX=9606 GN=CASP3 PE=1 SV=2
2	AFDB:Q95ND5	0.926	0.926	3.963E-55	277	0.884	0.884	Q95ND5.pdb.gz	CASP3_PIG Caspase-3 OS=Sus scrofa OX=9823 GN=CASP3 PE=1 SV=1
3	AFDB:P55213	0.896	0.896	8.507E-54	277	0.892	0.892	P55213.pdb.gz	CASP3_RAT Caspase-3 OS=Rattus norvegicus OX=10116 GN=Casp3 PE=2 SV=2
4	AFDB:Q8MKI5	0.903	0.903	9.056E-54	277	0.892	0.892	Q8MKI5.pdb.gz	CASP3_CANLF Caspase-3 OS=Canis lupus familiaris OX=9615 GN=CASP3 PE=2 SV=1
5	PDB:4pryA	0.854	0.949	1.391E-51	249	0.892	0.992	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
6	AFDB:O93417	0.872	0.854	3.927E-46	283	0.650	0.636	O93417.pdb.gz	O93417_CHICK Caspase-3 OS=Gallus gallus OX=9031 GN=CASP3 PE=1 SV=1
7	AFDB:H0Z8H6	0.844	0.830	8.975E-45	282	0.682	0.670	H0Z8H6.pdb.gz	H0Z8H6_TAEGU Caspase 3 OS=Taeniopygia guttata OX=59729 GN=CASP3 PE=3 SV=2
8	AFDB:Q4ZHV0	0.859	0.853	1.198E-41	279	0.574	0.570	Q4ZHV0.pdb.gz	Q4ZHV0_SALSA Caspase 3B OS=Salmo salar OX=8030 GN=CASP3 PE=2 SV=1
9	AFDB:G3IL63	0.850	0.778	3.103E-40	303	0.523	0.479	G3IL63.pdb.gz	G3IL63_CRIGR Caspase-7 OS=Cricetulus griseus OX=10029 GN=I79_024625 PE=1 SV=1
10	AFDB:A0A1C9CJ76	0.835	0.821	3.304E-40	282	0.556	0.546	A0A1C9CJ76.pdb.gz
11	AFDB:P55210	0.856	0.784	2.953E-39	303	0.505	0.462	P55210.pdb.gz	CASP7_HUMAN Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7 PE=1 SV=1
12	PDB:4fdlB	0.833	0.964	5.827E-37	239	0.484	0.561	4fdlB.pdb.gz
13	PDB:4nblA	0.771	0.825	4.223E-28	258	0.375	0.403	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
14	PDB:7wzsB	0.682	0.914	1.108E-25	206	0.408	0.549	7wzsB.pdb.gz
15	PDB:4iyrB	0.638	0.919	2.322E-21	191	0.318	0.461	4iyrB.pdb.gz
16	PDB:2wdpD	0.653	0.778	2.352E-20	230	0.372	0.448	2wdpD.pdb.gz
17	PDB:5nijA	0.488	0.328	1.076E-3	428	0.090	0.058	5nijA.pdb.gz
18	PDB:4af8A	0.535	0.457	1.298E-3	333	0.141	0.117	4af8A.pdb.gz
19	PDB:5wbjA	0.365	0.115	1.890E-3	1058	0.079	0.021	5wbjA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
20	PDB:6u62A	0.255	0.080	1.491E-2	1110	0.072	0.018	6u62A.pdb.gz	Structural basis for the docking of mTORC1 on the lysosomal surface.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P42574	0.0	579	277	1.000	1.000	CASP3_HUMAN Caspase-3 OS=Homo sapiens OX=9606 GN=CASP3 PE=1 SV=2
2	P55213	0.0	522	277	0.892	0.892	CASP3_RAT Caspase-3 OS=Rattus norvegicus OX=10116 GN=Casp3 PE=2 SV=2
3	P70677	0.0	512	277	0.866	0.866	CASP3_MOUSE Caspase-3 OS=Mus musculus OX=10090 GN=Casp3 PE=1 SV=1
4	Q8MKI5	0.0	523	277	0.892	0.892	CASP3_CANLF Caspase-3 OS=Canis lupus familiaris OX=9615 GN=CASP3 PE=2 SV=1
5	Q95ND5	0.0	514	277	0.884	0.884	CASP3_PIG Caspase-3 OS=Sus scrofa OX=9823 GN=CASP3 PE=1 SV=1
6	H0Z8H6	3.09e-138	392	282	0.682	0.670	H0Z8H6_TAEGU Caspase 3 OS=Taeniopygia guttata OX=59729 GN=CASP3 PE=3 SV=2
7	O93417	7.74e-134	381	283	0.650	0.636	O93417_CHICK Caspase-3 OS=Gallus gallus OX=9031 GN=CASP3 PE=1 SV=1
8	Q4ZHV0	3.35e-114	331	279	0.549	0.545	Q4ZHV0_SALSA Caspase 3B OS=Salmo salar OX=8030 GN=CASP3 PE=2 SV=1
9	Q98UI8	1.15e-107	315	282	0.538	0.528	Q98UI8_DANRE Caspase 3, apoptosis-related cysteine peptidase a OS=Danio rerio OX=7955 GN=casp3 PE=1 SV=1
10	F1NV61	6.33e-104	306	309	0.513	0.460	CASP7_CHICK Caspase-7 OS=Gallus gallus OX=9031 GN=CASP7 PE=3 SV=2
11	P97864	2.75e-101	300	303	0.520	0.475	CASP7_MOUSE Caspase-7 OS=Mus musculus OX=10090 GN=Casp7 PE=1 SV=2
12	A0A0G2K9Z4	2.28e-100	297	291	0.520	0.495	A0A0G2K9Z4_RAT Caspase 7 OS=Rattus norvegicus OX=10116 GN=Casp7 PE=1 SV=1
13	A0A8I5ZQU7	4.74e-100	296	301	0.520	0.478	A0A8I5ZQU7_RAT Caspase 7 OS=Rattus norvegicus OX=10116 GN=Casp7 PE=3 SV=1
14	G3IL63	1.22e-97	290	303	0.509	0.465	G3IL63_CRIGR Caspase-7 OS=Cricetulus griseus OX=10029 GN=I79_024625 PE=1 SV=1
15	P55210	3.23e-97	289	303	0.498	0.455	CASP7_HUMAN Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7 PE=1 SV=1
16	O08738	2.62e-65	207	276	0.375	0.377	CASP6_MOUSE Caspase-6 OS=Mus musculus OX=10090 GN=Casp6 PE=1 SV=1
17	P55212	5.19e-65	207	293	0.383	0.362	CASP6_HUMAN Caspase-6 OS=Homo sapiens OX=9606 GN=CASP6 PE=1 SV=2
18	A0A1D5PPP7	4.56e-63	202	304	0.368	0.336	CASP6_CHICK Caspase-6 OS=Gallus gallus OX=9031 GN=CASP6 PE=2 SV=2
19	O01382	5.26e-62	201	339	0.375	0.307	DRICE_DROME Caspase OS=Drosophila melanogaster OX=7227 GN=Drice PE=1 SV=2
20	O35397	2.03e-61	197	277	0.368	0.368	CASP6_RAT Caspase-6 OS=Rattus norvegicus OX=10116 GN=Casp6 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10256 Erf4	3e+02	12.9	Golgin subfamily A member 7/ERF4 family
2	PF00656 Peptidase_C14	2.3e-45	166.6	Caspase domain
3	PF12878 SICA_beta	4.2e+02	12.5	SICA extracellular beta domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003823509.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003823173.1	0.998	X-linked inhibitor of apoptosis
2	9597.XP_003814976.1	0.996	Poly-ADP-ribosyltransferase that mediates poly-ADP- ribosylation of proteins and plays a key role in DNA repair.
3	9597.XP_003832655.1	0.994	Oligomeric Apaf-1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis. This activation requires ATP.
4	9597.XP_003828433.1	0.988	Baculoviral IAP repeat-containing protein 2 isoform X1
5	9597.XP_008958802.1	0.988	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
6	9597.XP_003806305.1	0.986	Belongs to the peptidase C14A family.
7	9597.XP_003807970.1	0.985	Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.
8	9597.XP_003828436.1	0.985	Baculoviral IAP repeat containing 3
9	9597.XP_003822140.1	0.983	DNA fragmentation factor subunit alpha
10	9597.XP_008968764.1	0.979	Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.
11	9597.XP_003809164.1	0.976	Belongs to the peptidase S1 family.
12	9597.XP_003809948.1	0.976	Baculoviral IAP repeat containing 7
13	9597.XP_008970560.1	0.972	Cyclin-dependent kinase inhibitor 1
14	9597.XP_003820792.1	0.971	Belongs to the peptidase C14A family.
15	9597.XP_003811771.1	0.969	poly(ADP-ribose) polymerase 2
16	9597.XP_008974132.1	0.966	Spectrin alpha chain, non-erythrocytic 1 isoform X1
17	9597.XP_008972421.1	0.963	Belongs to the peptidase C14A family.
18	9597.XP_008959823.1	0.959	Mitogen-activated protein kinase 3
19	9597.XP_003808596.1	0.957	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 ESTs, 12 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
20	9597.XP_008961539.1	0.955	Belongs to the actin family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004197	0.999	cysteine-type endopeptidase activity
GO:0097153	0.973	cysteine-type endopeptidase activity involved in apoptotic process
GO:0019899	0.623	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.998	regulation of biological process
GO:0050896	0.995	response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0048518	0.988	positive regulation of biological process
GO:0051716	0.987	cellular response to stimulus
GO:0023052	0.978	signaling
GO:0032502	0.973	developmental process
GO:0071704	0.971	organic substance metabolic process
GO:0019222	0.963	regulation of metabolic process
GO:0048522	0.962	positive regulation of cellular process
GO:0044238	0.944	primary metabolic process
GO:0007154	0.941	cell communication
GO:0032501	0.928	multicellular organismal process
GO:0010941	0.928	regulation of cell death
GO:0007165	0.922	signal transduction
GO:0042981	0.908	regulation of apoptotic process
GO:0006807	0.905	nitrogen compound metabolic process
GO:0008219	0.897	cell death
GO:1901564	0.893	organonitrogen compound metabolic process
GO:0042221	0.890	response to chemical
GO:0043170	0.881	macromolecule metabolic process
GO:0006915	0.875	apoptotic process
GO:0043065	0.869	positive regulation of apoptotic process
GO:0070887	0.857	cellular response to chemical stimulus
GO:0019538	0.846	protein metabolic process
GO:0031323	0.837	regulation of cellular metabolic process
GO:0010033	0.808	response to organic substance
GO:0080090	0.804	regulation of primary metabolic process
GO:0060255	0.803	regulation of macromolecule metabolic process
GO:0051171	0.803	regulation of nitrogen compound metabolic process
GO:0009893	0.767	positive regulation of metabolic process
GO:0051246	0.702	regulation of protein metabolic process
GO:0097190	0.648	apoptotic signaling pathway
GO:0071310	0.641	cellular response to organic substance
GO:0048856	0.596	anatomical structure development
GO:0071495	0.592	cellular response to endogenous stimulus
GO:0006508	0.555	proteolysis
GO:0048519	0.524	negative regulation of biological process
GO:0010604	0.520	positive regulation of macromolecule metabolic process
GO:0051173	0.503	positive regulation of nitrogen compound metabolic process
GO:0006950	0.473	response to stress
GO:0031325	0.469	positive regulation of cellular metabolic process
GO:0048523	0.464	negative regulation of cellular process
GO:0010243	0.438	response to organonitrogen compound
GO:0019219	0.412	regulation of nucleobase-containing compound metabolic process
GO:0044237	0.403	cellular metabolic process
GO:0035556	0.397	intracellular signal transduction
GO:0071417	0.384	cellular response to organonitrogen compound
GO:0014070	0.375	response to organic cyclic compound
GO:0071312	0.361	cellular response to alkaloid
GO:0009889	0.327	regulation of biosynthetic process
GO:0051247	0.323	positive regulation of protein metabolic process
GO:0071840	0.305	cellular component organization or biogenesis
GO:0065009	0.304	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0070013	0.996	intracellular organelle lumen
GO:0005654	0.985	nucleoplasm
GO:0032991	0.948	protein-containing complex
GO:0016020	0.874	membrane
GO:1902494	0.440	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	0.999	Cysteine endopeptidases.

[back to server]