StarFunc result for job id P42575

User Input

>input (452 residues)
MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHL
LEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLT
TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCT
PEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDV
HVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLF
DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPT
RSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGY
APGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42575	1.000	1.000	4.152E-93	452	1.000	1.000	P42575.pdb.gz	CASP2_HUMAN Caspase-2 OS=Homo sapiens OX=9606 GN=CASP2 PE=1 SV=2
2	AFDB:P29594	0.932	0.932	2.783E-85	452	0.896	0.896	P29594.pdb.gz	CASP2_MOUSE Caspase-2 OS=Mus musculus OX=10090 GN=Casp2 PE=1 SV=5
3	AFDB:Q9IB67	0.676	0.718	9.939E-61	423	0.522	0.558	Q9IB67.pdb.gz	Q9IB67_XENLA Caspase 2 L homeolog OS=Xenopus laevis OX=8355 GN=casp2.L PE=1 SV=1
4	AFDB:A0A288CG41	0.594	0.614	8.580E-56	437	0.476	0.492	A0A288CG41.pdb.gz	A0A288CG41_DANRE Caspase 2 OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
5	AFDB:P42573	0.556	0.503	1.375E-35	503	0.261	0.235	P42573.pdb.gz	CED3_CAEEL Cell death protein 3 OS=Caenorhabditis elegans OX=6239 GN=ced-3 PE=1 SV=2
6	AFDB:F1NL59	0.523	0.564	1.289E-34	418	0.279	0.301	F1NL59.pdb.gz
7	AFDB:A0A2U9DQQ3	0.495	0.513	1.836E-34	436	0.288	0.298	A0A2U9DQQ3.pdb.gz
8	AFDB:P55211	0.505	0.548	2.772E-34	416	0.265	0.288	P55211.pdb.gz	CASP9_HUMAN Caspase-9 OS=Homo sapiens OX=9606 GN=CASP9 PE=1 SV=3
9	AFDB:Q8C3Q9	0.510	0.508	7.113E-34	454	0.270	0.269	Q8C3Q9.pdb.gz	CASP9_MOUSE Caspase-9 OS=Mus musculus OX=10090 GN=Casp9 PE=1 SV=1
10	AFDB:P43527	0.532	0.594	2.553E-30	402	0.230	0.259	P43527.pdb.gz	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
11	PDB:4fdlB	0.484	0.904	2.713E-23	239	0.162	0.305	4fdlB.pdb.gz
12	PDB:4pryA	0.493	0.885	2.697E-22	249	0.168	0.305	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
13	PDB:4nblA	0.467	0.805	6.044E-19	258	0.155	0.271	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
14	PDB:4iyrB	0.388	0.901	1.928E-15	191	0.131	0.309	4iyrB.pdb.gz
15	PDB:7wzsB	0.409	0.877	1.917E-14	206	0.135	0.296	7wzsB.pdb.gz
16	PDB:2wdpD	0.425	0.796	3.071E-14	230	0.153	0.300	2wdpD.pdb.gz
17	PDB:5juyB	0.214	0.089	3.709E-6	1234	0.102	0.037	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
18	PDB:4af8A	0.328	0.426	3.476E-5	333	0.077	0.105	4af8A.pdb.gz
19	PDB:4fguA	0.320	0.352	1.270E-4	407	0.066	0.074	4fguA.pdb.gz
20	PDB:5nijA	0.313	0.328	1.347E-4	428	0.093	0.098	5nijA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29594	0.0	812	452	0.896	0.896	CASP2_MOUSE Caspase-2 OS=Mus musculus OX=10090 GN=Casp2 PE=1 SV=5
2	P42575	0.0	939	452	1.000	1.000	CASP2_HUMAN Caspase-2 OS=Homo sapiens OX=9606 GN=CASP2 PE=1 SV=2
3	P55215	0.0	814	452	0.896	0.896	CASP2_RAT Caspase-2 OS=Rattus norvegicus OX=10116 GN=Casp2 PE=1 SV=3
4	Q9IB67	1.14e-167	480	423	0.527	0.563	Q9IB67_XENLA Caspase 2 L homeolog OS=Xenopus laevis OX=8355 GN=casp2.L PE=1 SV=1
5	Q0PKX3	4.04e-136	400	435	0.482	0.501	Q0PKX3_DANRE Caspase 2, apoptosis-related cysteine peptidase OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
6	A0A288CG41	3.10e-134	395	437	0.482	0.499	A0A288CG41_DANRE Caspase 2 OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
7	F1QSB1	2.33e-48	173	436	0.279	0.289	F1QSB1_DANRE Caspase 9, apoptosis-related cysteine peptidase OS=Danio rerio OX=7955 GN=im:7136887 PE=1 SV=1
8	Q8C3Q9	2.52e-42	157	454	0.277	0.275	CASP9_MOUSE Caspase-9 OS=Mus musculus OX=10090 GN=Casp9 PE=1 SV=1
9	D3YT61	2.17e-41	150	287	0.199	0.314	D3YT61_CAEEL Cell death protein 3 subunit p17 OS=Caenorhabditis elegans OX=6239 GN=ced-3 PE=1 SV=1
10	Q9JHK1	6.97e-40	150	454	0.281	0.280	Q9JHK1_RAT Caspase-9 OS=Rattus norvegicus OX=10116 GN=Casp9 PE=1 SV=1
11	P42573	1.42e-39	150	503	0.199	0.179	CED3_CAEEL Cell death protein 3 OS=Caenorhabditis elegans OX=6239 GN=ced-3 PE=1 SV=2
12	Q4ZHV0	3.56e-39	144	279	0.184	0.297	Q4ZHV0_SALSA Caspase 3B OS=Salmo salar OX=8030 GN=CASP3 PE=2 SV=1
13	Q90WU0	1.82e-38	145	403	0.246	0.275	Q90WU0_CHICK Caspase 9 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
14	P55211	7.27e-38	144	416	0.265	0.288	CASP9_HUMAN Caspase-9 OS=Homo sapiens OX=9606 GN=CASP9 PE=1 SV=3
15	O93417	3.61e-36	136	283	0.177	0.283	O93417_CHICK Caspase-3 OS=Gallus gallus OX=9031 GN=CASP3 PE=1 SV=1
16	H0Z8H6	7.69e-36	135	282	0.177	0.284	H0Z8H6_TAEGU Caspase 3 OS=Taeniopygia guttata OX=59729 GN=CASP3 PE=3 SV=2
17	Q98UI8	1.17e-35	135	282	0.204	0.326	Q98UI8_DANRE Caspase 3, apoptosis-related cysteine peptidase a OS=Danio rerio OX=7955 GN=casp3 PE=1 SV=1
18	F1NV61	2.29e-35	135	309	0.186	0.272	CASP7_CHICK Caspase-7 OS=Gallus gallus OX=9031 GN=CASP7 PE=3 SV=2
19	A0A0G2K9Z4	4.53e-33	128	291	0.170	0.265	A0A0G2K9Z4_RAT Caspase 7 OS=Rattus norvegicus OX=10116 GN=Casp7 PE=1 SV=1
20	G3IL63	4.69e-33	129	303	0.177	0.264	G3IL63_CRIGR Caspase-7 OS=Cricetulus griseus OX=10029 GN=I79_024625 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	1.1e-15	68.7	Caspase recruitment domain
2	PF16739 CARD_2	0.42	22.0	Caspase recruitment domain
3	PF00656 Peptidase_C14	2.4e-32	124.1	Caspase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312664

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337797	0.999	P53-induced death domain-containing protein 1
2	9606.ENSP00000439068	0.999	Death domain-containing protein CRADD
3	9606.ENSP00000358327	0.982	Caspase-7
4	9606.ENSP00000162749	0.976	Tumor necrosis factor receptor superfamily member 1A
5	9606.ENSP00000263464	0.965	Baculoviral IAP repeat-containing protein 3
6	9606.ENSP00000259808	0.964	Receptor-interacting serine/threonine-protein kinase 1
7	9606.ENSP00000301838	0.963	FAS-associated death domain protein
8	9606.ENSP00000362994	0.959	TNF receptor-associated factor 1
9	9606.ENSP00000311032	0.958	Caspase-3
10	9606.ENSP00000341268	0.949	Tumor necrosis factor receptor type 1-associated DEATH domain protein
11	9606.ENSP00000379287	0.948	14-3-3 protein zeta/delta
12	9606.ENSP00000247668	0.946	TNF receptor-associated factor 2
13	9606.ENSP00000361728	0.946	Protein BEX3
14	9606.ENSP00000398698	0.944	Tumor necrosis factor
15	9606.ENSP00000318822	0.940	BH3-interacting domain death agonist
16	9606.ENSP00000351908	0.940	Mitogen-activated protein kinase kinase kinase 5
17	9606.ENSP00000381070	0.933	Dual specificity mitogen-activated protein kinase kinase 7
18	9606.ENSP00000261366	0.928	Lamin-B1
19	9606.ENSP00000358525	0.927	Beta-nerve growth factor
20	9606.ENSP00000265164	0.924	Caspase-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004197	1.000	cysteine-type endopeptidase activity
GO:0042802	0.979	identical protein binding
GO:0019904	0.927	protein domain specific binding
GO:0097153	0.855	cysteine-type endopeptidase activity involved in apoptotic process
GO:0019899	0.543	enzyme binding
GO:0098772	0.457	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0048522	0.995	positive regulation of cellular process
GO:0050896	0.994	response to stimulus
GO:0012501	0.992	programmed cell death
GO:0007154	0.986	cell communication
GO:0006915	0.984	apoptotic process
GO:0007165	0.984	signal transduction
GO:0043067	0.978	regulation of programmed cell death
GO:0071704	0.977	organic substance metabolic process
GO:0044238	0.971	primary metabolic process
GO:0043068	0.966	positive regulation of programmed cell death
GO:0043065	0.957	positive regulation of apoptotic process
GO:0097190	0.954	apoptotic signaling pathway
GO:0006807	0.950	nitrogen compound metabolic process
GO:0043170	0.946	macromolecule metabolic process
GO:0006950	0.929	response to stress
GO:0019538	0.895	protein metabolic process
GO:0048856	0.875	anatomical structure development
GO:0006508	0.867	proteolysis
GO:0019222	0.860	regulation of metabolic process
GO:0006974	0.828	cellular response to DNA damage stimulus
GO:0009966	0.818	regulation of signal transduction
GO:0080090	0.806	regulation of primary metabolic process
GO:0060255	0.804	regulation of macromolecule metabolic process
GO:0051171	0.802	regulation of nitrogen compound metabolic process
GO:0032501	0.785	multicellular organismal process
GO:0009605	0.778	response to external stimulus
GO:0048523	0.776	negative regulation of cellular process
GO:0097193	0.768	intrinsic apoptotic signaling pathway
GO:0048584	0.699	positive regulation of response to stimulus
GO:0071840	0.666	cellular component organization or biogenesis
GO:0051604	0.646	protein maturation
GO:0009628	0.601	response to abiotic stimulus
GO:0051726	0.570	regulation of cell cycle
GO:0009967	0.558	positive regulation of signal transduction
GO:0009893	0.526	positive regulation of metabolic process
GO:0016043	0.523	cellular component organization
GO:0010604	0.498	positive regulation of macromolecule metabolic process
GO:0065009	0.463	regulation of molecular function
GO:0051173	0.436	positive regulation of nitrogen compound metabolic process
GO:0051246	0.414	regulation of protein metabolic process
GO:0044237	0.409	cellular metabolic process
GO:0048869	0.405	cellular developmental process
GO:0030154	0.404	cell differentiation
GO:0042770	0.404	signal transduction in response to DNA damage
GO:0007275	0.400	multicellular organism development
GO:0045786	0.398	negative regulation of cell cycle
GO:1902531	0.380	regulation of intracellular signal transduction
GO:0050790	0.378	regulation of catalytic activity
GO:0008630	0.374	intrinsic apoptotic signaling pathway in response to DNA damage
GO:1901987	0.370	regulation of cell cycle phase transition
GO:2001233	0.367	regulation of apoptotic signaling pathway
GO:0031323	0.366	regulation of cellular metabolic process
GO:0051336	0.362	regulation of hydrolase activity
GO:0030162	0.354	regulation of proteolysis
GO:0043069	0.342	negative regulation of programmed cell death
GO:0042221	0.341	response to chemical
GO:0003006	0.338	developmental process involved in reproduction
GO:0052548	0.326	regulation of endopeptidase activity
GO:0010948	0.307	negative regulation of cell cycle process
GO:0072331	0.301	signal transduction by p53 class mediator

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0016020	0.995	membrane
GO:0005829	0.986	cytosol
GO:0032991	0.967	protein-containing complex
GO:0070013	0.901	intracellular organelle lumen
GO:0005739	0.494	mitochondrion
GO:1902494	0.387	catalytic complex
GO:1905369	0.340	endopeptidase complex
GO:0008303	0.334	caspase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.

[back to server]