StarFunc result for job id P42658

User Input

>input (865 residues)
MASLYQRFTGKINTSRSFPAPPEASHLLGGQGPEEDGGAGAKPLGPRAQAAAPRERGGGG
GGAGGRPRFQYQARSDGDEEDELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA
EDNSLSQKKKVTVEDLFSEDFKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIE
GKKIESLRAIRYEISPDREYALFSYNVEPIYQHSYTGYYVLSKIPHGDPQSLDPPEVSNA
KLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKT
HIAHWWSPDGTRLAYAAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIG
LNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTK
KHEDESEAWLHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQSI
TSGDWDVTKILAYDEKGNKIYFLSTEDLPRRRQLYSANTVGNFNRQCLSCDLVENCTYFS
ASFSHSMDFFLLKCEGPGVPMVTVHNTTDKKKMFDLETNEHVKKAINDRQMPKVEYRDIE
IDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKC
DGRGSGFQGTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTY
ILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKVAHRVSALE
EQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQHLYRSII
NFFVECFRIQDKLLTVTAKEDEEED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42658	1.000	1.000	0.000	865	1.000	1.000	P42658.pdb.gz	DPP6_HUMAN Dipeptidyl aminopeptidase-like protein 6 OS=Homo sapiens OX=9606 GN=DPP6 PE=1 SV=2
2	AFDB:Q6NXK7	0.851	0.922	0.000	797	0.461	0.501	Q6NXK7.pdb.gz	DPP10_MOUSE Inactive dipeptidyl peptidase 10 OS=Mus musculus OX=10090 GN=Dpp10 PE=1 SV=1
3	AFDB:Q8N608	0.830	0.901	0.000	796	0.477	0.519	Q8N608.pdb.gz	DPP10_HUMAN Inactive dipeptidyl peptidase 10 OS=Homo sapiens OX=9606 GN=DPP10 PE=1 SV=2
4	PDB:4wjlB	0.814	0.977	1.657E-96	719	0.437	0.526	4wjlB.pdb.gz
5	AFDB:M1PFC6	0.802	0.910	9.758E-80	760	0.286	0.325	M1PFC6.pdb.gz	M1PFC6_PIPPI Dipeptidyl-peptidase 4 OS=Pipistrellus pipistrellus OX=59474 GN=DPP4 PE=1 SV=1
6	AFDB:P97321	0.794	0.899	4.905E-79	761	0.279	0.317	P97321.pdb.gz	SEPR_MOUSE Prolyl endopeptidase FAP OS=Mus musculus OX=10090 GN=Fap PE=1 SV=1
7	AFDB:P14740	0.796	0.895	7.961E-79	767	0.291	0.329	P14740.pdb.gz	DPP4_RAT Dipeptidyl peptidase 4 OS=Rattus norvegicus OX=10116 GN=Dpp4 PE=1 SV=2
8	AFDB:X2J9P4	0.828	0.764	4.223E-78	940	0.308	0.283	X2J9P4.pdb.gz	X2J9P4_DROME Dipeptidyl peptidase 10, isoform B OS=Drosophila melanogaster OX=7227 GN=Dpp10 PE=4 SV=1
9	AFDB:Q12884	0.791	0.897	8.056E-78	760	0.287	0.326	Q12884.pdb.gz	SEPR_HUMAN Prolyl endopeptidase FAP OS=Homo sapiens OX=9606 GN=FAP PE=1 SV=5
10	AFDB:P27487	0.790	0.889	5.300E-77	766	0.282	0.319	P27487.pdb.gz	DPP4_HUMAN Dipeptidyl peptidase 4 OS=Homo sapiens OX=9606 GN=DPP4 PE=1 SV=2
11	PDB:6y0fC	0.775	0.924	3.266E-75	722	0.271	0.324	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
12	PDB:4n8eB	0.782	0.918	4.051E-75	734	0.275	0.324	4n8eB.pdb.gz	Discovery of C-(1-aryl-cyclohexyl)-methylamines as selective, orally available inhibitors of dipeptidyl peptidase IV.
13	PDB:2gbfA	0.785	0.926	7.022E-74	730	0.283	0.336	2gbfA.pdb.gz	Crystal Structures of DPP-IV (CD26) from Rat Kidney Exhibit Flexible Accommodation of Peptidase-Selective Inhibitors.
14	AFDB:A2RVG6	0.776	0.649	2.070E-70	1040	0.265	0.220	A2RVG6.pdb.gz	A2RVG6_DROME IP17501p OS=Drosophila melanogaster OX=7227 GN=ome PE=1 SV=1
15	PDB:6eorB	0.669	0.715	6.951E-43	805	0.199	0.214	6eorB.pdb.gz	Structures and mechanism of dipeptidyl peptidases 8 and 9, important players in cellular homeostasis and cancer.
16	PDB:7jn7A	0.660	0.674	1.013E-42	846	0.206	0.210	7jn7A.pdb.gz	Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment.
17	PDB:7ayqA	0.652	0.695	1.358E-40	808	0.182	0.194	7ayqA.pdb.gz	Chemoproteomics-Enabled Identification of 4-Oxo-beta-Lactams as Inhibitors of Dipeptidyl Peptidases 8 and 9.
18	PDB:7svmA	0.665	0.674	1.684E-40	852	0.186	0.189	7svmA.pdb.gz	A Phenotypic Screen Identifies Potent DPP9 Inhibitors Capable of Killing HIV-1 Infected Cells.
19	PDB:2xe4A	0.507	0.595	3.001E-23	721	0.106	0.128	2xe4A.pdb.gz	Crystal Structure of Leishmania Major Oligopeptidase B Gives Insight Into the Enzymatic Properties of a Trypanosomatid Virulence Factor.
20	PDB:3dduA	0.526	0.629	5.424E-23	707	0.099	0.122	3dduA.pdb.gz	Pyrrolidinyl pyridone and pyrazinone analogues as potent inhibitors of prolyl oligopeptidase (POP)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P42658	0.0	1810	865	1.000	1.000	DPP6_HUMAN Dipeptidyl aminopeptidase-like protein 6 OS=Homo sapiens OX=9606 GN=DPP6 PE=1 SV=2
2	P46101	0.0	1685	859	0.927	0.934	DPP6_RAT Dipeptidyl aminopeptidase-like protein 6 OS=Rattus norvegicus OX=10116 GN=Dpp6 PE=1 SV=1
3	Q6NXK7	0.0	858	797	0.461	0.501	DPP10_MOUSE Inactive dipeptidyl peptidase 10 OS=Mus musculus OX=10090 GN=Dpp10 PE=1 SV=1
4	Q6Q629	0.0	857	796	0.457	0.496	DPP10_RAT Inactive dipeptidyl peptidase 10 OS=Rattus norvegicus OX=10116 GN=Dpp10 PE=1 SV=1
5	Q8N608	0.0	879	796	0.477	0.519	DPP10_HUMAN Inactive dipeptidyl peptidase 10 OS=Homo sapiens OX=9606 GN=DPP10 PE=1 SV=2
6	Q9Z218	0.0	1531	804	0.843	0.907	DPP6_MOUSE Dipeptidyl aminopeptidase-like protein 6 OS=Mus musculus OX=10090 GN=Dpp6 PE=1 SV=1
7	P14740	2.28e-144	447	767	0.291	0.329	DPP4_RAT Dipeptidyl peptidase 4 OS=Rattus norvegicus OX=10116 GN=Dpp4 PE=1 SV=2
8	P97321	2.75e-143	444	761	0.284	0.323	SEPR_MOUSE Prolyl endopeptidase FAP OS=Mus musculus OX=10090 GN=Fap PE=1 SV=1
9	P28843	8.63e-143	442	760	0.289	0.329	DPP4_MOUSE Dipeptidyl peptidase 4 OS=Mus musculus OX=10090 GN=Dpp4 PE=1 SV=3
10	Q12884	6.78e-141	437	760	0.289	0.329	SEPR_HUMAN Prolyl endopeptidase FAP OS=Homo sapiens OX=9606 GN=FAP PE=1 SV=5
11	M1PFC6	6.68e-140	435	760	0.284	0.324	M1PFC6_PIPPI Dipeptidyl-peptidase 4 OS=Pipistrellus pipistrellus OX=59474 GN=DPP4 PE=1 SV=1
12	P27487	7.21e-139	432	766	0.286	0.322	DPP4_HUMAN Dipeptidyl peptidase 4 OS=Homo sapiens OX=9606 GN=DPP4 PE=1 SV=2
13	Q9VUH1	2.73e-97	324	802	0.245	0.264	Q9VUH1_DROME LD21715p OS=Drosophila melanogaster OX=7227 GN=ome PE=1 SV=1
14	M9PCH6	2.84e-97	323	784	0.245	0.270	M9PCH6_DROME Omega, isoform H OS=Drosophila melanogaster OX=7227 GN=ome PE=1 SV=1
15	Q29R16	1.38e-96	325	923	0.245	0.230	Q29R16_DROME LP13067p OS=Drosophila melanogaster OX=7227 GN=ome PE=1 SV=1
16	A2RVG6	5.50e-96	325	1040	0.265	0.220	A2RVG6_DROME IP17501p OS=Drosophila melanogaster OX=7227 GN=ome PE=1 SV=1
17	Q9VMM2	2.08e-89	301	751	0.234	0.269	Q9VMM2_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11034 PE=4 SV=2
18	Q2UH35	6.15e-83	284	771	0.252	0.283	DPP4_ASPOR Dipeptidyl peptidase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=dpp4 PE=1 SV=1
19	P18962	1.52e-81	281	818	0.255	0.270	DAP2_YEAST Dipeptidyl aminopeptidase B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAP2 PE=1 SV=2
20	Q5AZ42	2.26e-80	277	773	0.239	0.268	DPP4_EMENI Probable dipeptidyl peptidase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=dpp4 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01738 DLH	48	14.9	Dienelactone hydrolase family
2	PF00930 DPPIV_N	8.4e-109	375.2	Dipeptidyl peptidase IV (DPP IV) N-terminal region
3	PF07676 PD40	0.00031	31.9	WD40-like Beta Propeller Repeat
4	PF00326 Peptidase_S9	2.2e-36	136.9	Prolyl oligopeptidase family
5	PF05915 TMEM_230_134	3.4e+02	12.8	Transmembrane proteins 230/134

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367001

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333496	0.985	Potassium voltage-gated channel subfamily D member 2
2	9606.ENSP00000265969	0.977	Potassium voltage-gated channel subfamily C member 1
3	9606.ENSP00000368752	0.891	Major prion protein
4	9606.ENSP00000420040	0.881	Kv channel-interacting protein 2
5	9606.ENSP00000270642	0.850	IgLON family member 5
6	9606.ENSP00000414886	0.835	Potassium voltage-gated channel interacting protein 1
7	9606.ENSP00000328511	0.813	Potassium voltage-gated channel subfamily A member 4
8	9606.ENSP00000319591	0.811	Potassium voltage-gated channel subfamily D member 3
9	9606.ENSP00000429344	0.802	Paraneoplastic Ma antigens
10	9606.ENSP00000360472	0.792	Leucine-rich glioma-inactivated protein 1
11	9606.ENSP00000295225	0.749	Calsenilin
12	9606.ENSP00000354778	0.741	Contactin-associated protein-like 2
13	9606.ENSP00000410257	0.727	Sodium channel protein type 5 subunit alpha
14	9606.ENSP00000345229	0.724	Delta and Notch-like epidermal growth factor-related receptor
15	9606.ENSP00000400258	0.720	Disks large-associated protein 2
16	9606.ENSP00000435509	0.711	Zinc finger protein ZIC 4
17	9606.ENSP00000479207	0.692	Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5
18	9606.ENSP00000360262	0.688	FGGY carbohydrate kinase domain containing
19	9606.ENSP00000365437	0.671	Glutamate decarboxylase 2
20	9606.ENSP00000371587	0.669	Kv channel-interacting protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0015459	0.989	potassium channel regulator activity
GO:0008233	0.690	peptidase activity
GO:0008239	0.481	dipeptidyl-peptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043266	0.997	regulation of potassium ion transport
GO:0050794	0.993	regulation of cellular process
GO:0034762	0.868	regulation of transmembrane transport
GO:0034765	0.855	regulation of monoatomic ion transmembrane transport
GO:1904062	0.852	regulation of monoatomic cation transmembrane transport
GO:0009987	0.835	cellular process
GO:1901379	0.778	regulation of potassium ion transmembrane transport
GO:0048518	0.470	positive regulation of biological process
GO:0032501	0.406	multicellular organismal process
GO:0048522	0.402	positive regulation of cellular process
GO:0051179	0.353	localization
GO:0007154	0.329	cell communication
GO:0006810	0.318	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098797	0.998	plasma membrane protein complex
GO:0034702	0.997	ion channel complex
GO:0008076	0.992	voltage-gated potassium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.690	Acting on peptide bonds (peptidases).
EC:3.4.14.5	0.481	dipeptidyl-peptidase IV.
EC:3.4.14.4	0.481	dipeptidyl-peptidase III.
EC:3.4.14.2	0.481	dipeptidyl-peptidase II.
EC:3.4.14.1	0.481	dipeptidyl-peptidase I.

[back to server]