StarFunc result for job id P42679

User Input

>input (507 residues)
MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHT
RPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLM
PWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTI
DEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQ
IGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGL
YIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILV
SEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSY
GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLAR
ELRSAGAPASVSGQDADGSTSPRSQEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42679	1.000	1.000	1.302E-99	507	1.000	1.000	P42679.pdb.gz	MATK_HUMAN Megakaryocyte-associated tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=MATK PE=1 SV=1
2	AFDB:P32577	0.801	0.898	2.090E-62	450	0.465	0.524	P32577.pdb.gz	CSK_RAT Tyrosine-protein kinase CSK OS=Rattus norvegicus OX=10116 GN=Csk PE=1 SV=1
3	AFDB:A0JMN4	0.792	0.886	6.268E-62	450	0.450	0.507	A0JMN4.pdb.gz	A0JMN4_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:154049 PE=1 SV=1
4	PDB:1k9aB	0.726	0.823	2.145E-53	441	0.464	0.533	1k9aB.pdb.gz
5	AFDB:Q8INJ8	0.545	0.273	1.664E-50	1052	0.393	0.189	Q8INJ8.pdb.gz	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
6	AFDB:G5ECJ6	0.506	0.477	1.081E-48	539	0.369	0.347	G5ECJ6.pdb.gz	CSK1_CAEEL Tyrosine-protein kinase csk-1 OS=Caenorhabditis elegans OX=6239 GN=csk-1 PE=1 SV=1
7	AFDB:A0A024R8E2	0.505	0.236	8.777E-46	1130	0.339	0.152	A0A024R8E2.pdb.gz
8	AFDB:W5U6C9	0.517	0.524	1.893E-45	500	0.331	0.336	W5U6C9.pdb.gz	W5U6C9_ICTPU Tyrosine-protein kinase OS=Ictalurus punctatus OX=7998 GN=LCK PE=2 SV=1
9	AFDB:E9PT20	0.511	0.234	2.232E-45	1143	0.331	0.147	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
10	AFDB:P03949	0.519	0.222	2.232E-45	1224	0.341	0.141	P03949.pdb.gz	ABL1_CAEEL Tyrosine-protein kinase abl-1 OS=Caenorhabditis elegans OX=6239 GN=abl-1 PE=1 SV=4
11	AFDB:P00522	0.507	0.168	4.816E-45	1620	0.347	0.109	P00522.pdb.gz	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
12	PDB:2h8hA	0.472	0.534	1.734E-37	445	0.316	0.360	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.461	0.422	6.605E-32	555	0.284	0.259	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.465	0.429	1.687E-30	551	0.254	0.234	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.425	0.729	1.271E-18	283	0.152	0.272	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:2qkwB	0.432	0.718	3.245E-17	292	0.148	0.257	2qkwB.pdb.gz
17	PDB:4zhxA	0.434	0.531	3.827E-17	409	0.146	0.181	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:5ufuA	0.448	0.605	4.271E-17	369	0.132	0.182	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
19	PDB:6b1uA	0.449	0.511	9.733E-17	442	0.140	0.161	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
20	PDB:1unlA	0.436	0.732	1.086E-16	292	0.122	0.212	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P42679	0.0	1044	507	1.000	1.000	MATK_HUMAN Megakaryocyte-associated tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=MATK PE=1 SV=1
2	P32577	8.40e-172	493	450	0.464	0.522	CSK_RAT Tyrosine-protein kinase CSK OS=Rattus norvegicus OX=10116 GN=Csk PE=1 SV=1
3	P41241	9.47e-172	493	450	0.464	0.522	CSK_MOUSE Tyrosine-protein kinase CSK OS=Mus musculus OX=10090 GN=Csk PE=1 SV=2
4	P41240	9.57e-172	493	450	0.464	0.522	CSK_HUMAN Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1
5	A0JMN4	2.30e-169	487	450	0.446	0.502	A0JMN4_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:154049 PE=1 SV=1
6	Q7KSQ2	9.88e-127	388	723	0.367	0.257	Q7KSQ2_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=1
7	Q9VGK8	4.28e-126	388	805	0.367	0.231	Q9VGK8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=3
8	Q8INJ8	2.64e-124	390	1052	0.367	0.177	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
9	G5ECJ6	3.64e-109	337	539	0.363	0.341	CSK1_CAEEL Tyrosine-protein kinase csk-1 OS=Caenorhabditis elegans OX=6239 GN=csk-1 PE=1 SV=1
10	W5U6C9	2.77e-93	294	500	0.316	0.320	W5U6C9_ICTPU Tyrosine-protein kinase OS=Ictalurus punctatus OX=7998 GN=LCK PE=2 SV=1
11	Q01621	3.26e-92	292	509	0.323	0.322	LCK_RAT Proto-oncogene tyrosine-protein kinase LCK OS=Rattus norvegicus OX=10116 GN=Lck PE=1 SV=3
12	P06240	1.24e-91	290	509	0.321	0.320	LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus OX=10090 GN=Lck PE=1 SV=4
13	Q66I04	2.27e-91	290	510	0.298	0.296	Q66I04_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:92124 PE=2 SV=1
14	P06239	2.91e-90	287	509	0.316	0.314	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
15	P00523	9.31e-89	283	533	0.329	0.313	SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus OX=9031 GN=SRC PE=1 SV=4
16	P25020	3.55e-88	282	526	0.327	0.316	SRC_RSVH1 Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain H-19) OX=11887 GN=V-SRC PE=1 SV=3
17	P05480	2.64e-87	280	535	0.327	0.310	SRC_MOUSE Proto-oncogene tyrosine-protein kinase Src OS=Mus musculus OX=10090 GN=Src PE=1 SV=5
18	Q9WUD9	2.68e-87	280	536	0.327	0.310	SRC_RAT Proto-oncogene tyrosine-protein kinase Src OS=Rattus norvegicus OX=10116 GN=Src PE=1 SV=4
19	P12931	2.80e-87	280	536	0.327	0.310	SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3
20	P08631	5.92e-87	279	526	0.314	0.302	HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	3.3e+02	12.5	Phosphotransferase enzyme family
2	PF14531 Kinase-like	4	18.3	Kinase-like
3	PF00069 Pkinase	1.3e-39	147.8	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	5.7e-84	293.0	Protein tyrosine and serine/threonine kinase
5	PF01163 RIO1	50	14.9	RIO1 family
6	PF00017 SH2	5e-17	73.1	SH2 domain
7	PF00018 SH3_1	0.0036	28.2	SH3 domain
8	PF07653 SH3_2	3.2	18.9	Variant SH3 domain
9	PF08239 SH3_3	1.3e+02	14.3	Bacterial SH3 domain
10	PF14604 SH3_9	4.1	18.7	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003819312.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003831321.1	0.953	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1
2	9597.XP_003821077.2	0.933	Neurotrophic receptor tyrosine kinase 1
3	9597.XP_008959616.1	0.884	Neurotrophic receptor tyrosine kinase 2
4	9597.XP_008972101.1	0.884	Neurotrophic receptor tyrosine kinase 3
5	9597.XP_008952425.1	0.875	Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
6	9597.XP_008956034.1	0.834	Paxillin
7	9597.XP_003805703.1	0.833	Protein tyrosine phosphatase, non-receptor type 22
8	9597.XP_008974002.1	0.794	Tyrosine-protein kinase Fyn isoform X1
9	9597.XP_008971926.1	0.792	CD4 molecule
10	9597.XP_003828369.1	0.782	Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis.
11	9597.XP_003808702.1	0.776	May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity
12	9597.XP_003810380.1	0.776	Docking protein 1
13	9597.XP_008955053.1	0.766	Erb-b2 receptor tyrosine kinase 2
14	9597.XP_008967087.1	0.766	Epidermal growth factor receptor
15	9597.XP_008967848.1	0.766	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 311 ESTs, 9 Proteins, and 71% coverage of the annotated genomic feature by RNAseq alignments
16	9597.XP_003807551.1	0.764	Transforming growth factor beta-1-induced transcript 1 protein isoform X1
17	9597.XP_008955538.1	0.763	SRC proto-oncogene, non-receptor tyrosine kinase
18	9597.XP_003815698.1	0.760	YES proto-oncogene 1, Src family tyrosine kinase
19	9597.XP_008953150.1	0.750	BCAR1, Cas family scaffolding protein
20	9597.XP_003827610.1	0.748	Fyn related Src family tyrosine kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004713	0.999	protein tyrosine kinase activity
GO:0019899	0.864	enzyme binding
GO:0019901	0.499	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0008152	0.985	metabolic process
GO:0071704	0.980	organic substance metabolic process
GO:0048518	0.976	positive regulation of biological process
GO:0044237	0.971	cellular metabolic process
GO:0006807	0.970	nitrogen compound metabolic process
GO:0048522	0.964	positive regulation of cellular process
GO:1901564	0.959	organonitrogen compound metabolic process
GO:0006468	0.953	protein phosphorylation
GO:0050896	0.919	response to stimulus
GO:0051716	0.808	cellular response to stimulus
GO:0042127	0.785	regulation of cell population proliferation
GO:0023052	0.614	signaling
GO:0007154	0.564	cell communication
GO:0007165	0.540	signal transduction
GO:0048583	0.467	regulation of response to stimulus
GO:0048519	0.426	negative regulation of biological process
GO:0060255	0.416	regulation of macromolecule metabolic process
GO:0048523	0.410	negative regulation of cellular process
GO:0032502	0.387	developmental process
GO:0008284	0.371	positive regulation of cell population proliferation
GO:0009893	0.360	positive regulation of metabolic process
GO:0051171	0.340	regulation of nitrogen compound metabolic process
GO:0080090	0.333	regulation of primary metabolic process
GO:0031323	0.324	regulation of cellular metabolic process
GO:0007166	0.323	cell surface receptor signaling pathway
GO:0032501	0.318	multicellular organismal process
GO:0048856	0.318	anatomical structure development
GO:0010604	0.313	positive regulation of macromolecule metabolic process
GO:0051173	0.300	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.907	membrane
GO:0071944	0.901	cell periphery
GO:0005886	0.891	plasma membrane
GO:0043226	0.836	organelle
GO:0043227	0.828	membrane-bounded organelle
GO:0043229	0.645	intracellular organelle
GO:0005576	0.468	extracellular region
GO:0043231	0.374	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.999	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]

[back to server]