StarFunc result for job id P42680

User Input

>input (631 residues)
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIK
CVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKY
HPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNS
EEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSN
NLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHY
HIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSY
EKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKL
THPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYL
ERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYS
RFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLR
CWQEKPEGRPSFEDLLRTIDELVECEETFGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2KA94	0.944	0.885	0.000	674	0.952	0.892	A0A0G2KA94.pdb.gz	A0A0G2KA94_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
2	AFDB:Q8JH64	0.874	0.841	1.313E-76	657	0.559	0.537	Q8JH64.pdb.gz	BTK_CHICK Tyrosine-protein kinase BTK OS=Gallus gallus OX=9031 GN=BTK PE=1 SV=1
3	AFDB:F8W3B7	0.664	0.655	4.009E-76	640	0.536	0.528	F8W3B7.pdb.gz	F8W3B7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=btk PE=3 SV=1
4	AFDB:Q03526	0.681	0.688	1.560E-75	625	0.571	0.576	Q03526.pdb.gz	ITK_MOUSE Tyrosine-protein kinase ITK/TSK OS=Mus musculus OX=10090 GN=Itk PE=1 SV=1
5	AFDB:A0A0G2K134	0.735	0.703	3.841E-74	662	0.537	0.512	A0A0G2K134.pdb.gz	A0A0G2K134_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
6	AFDB:P51813	0.467	0.438	8.592E-64	675	0.491	0.459	P51813.pdb.gz	BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens OX=9606 GN=BMX PE=1 SV=1
7	AFDB:P08630	0.672	0.544	3.344E-63	786	0.469	0.377	P08630.pdb.gz	BTKL_DROME Tyrosine-protein kinase Btk OS=Drosophila melanogaster OX=7227 GN=Btk PE=2 SV=2
8	AFDB:P42682	0.692	0.824	9.374E-59	527	0.456	0.546	P42682.pdb.gz	TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus OX=10090 GN=Txk PE=1 SV=1
9	AFDB:P42681	0.682	0.812	1.361E-55	527	0.468	0.560	P42681.pdb.gz	TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens OX=9606 GN=TXK PE=1 SV=3
10	AFDB:A0A0G2K6M9	0.631	0.719	1.617E-54	550	0.460	0.527	A0A0G2K6M9.pdb.gz	A0A0G2K6M9_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
11	PDB:2h8hA	0.613	0.846	1.238E-39	445	0.269	0.382	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.406	0.570	1.685E-33	441	0.263	0.376	1k9aB.pdb.gz
13	PDB:4fl2A	0.383	0.433	1.994E-25	555	0.190	0.216	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.401	0.456	4.335E-25	551	0.198	0.227	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.332	0.695	7.095E-14	283	0.117	0.261	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:5ufuA	0.344	0.568	8.207E-14	369	0.098	0.168	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
17	PDB:6s73A	0.361	0.812	1.270E-13	269	0.090	0.212	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:1unlA	0.340	0.701	3.043E-13	292	0.089	0.192	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
19	PDB:4rerA	0.340	0.458	3.194E-13	459	0.101	0.139	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:7mfdA	0.356	0.531	4.072E-13	410	0.128	0.198	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K134	660	637	0.534	0.529	A0A0G2K134_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
2	A0A0G2K6M9	724	661	0.564	0.539	A0A0G2K6M9_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
3	A0A0G2KA94	1233	674	0.943	0.883	A0A0G2KA94_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
4	A0A8I5ZXG2	1176	607	0.910	0.946	A0A8I5ZXG2_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
5	A0A8I6A3K6	1178	681	0.902	0.836	A0A8I6A3K6_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
6	A0A8I6GBZ8	1165	602	0.903	0.947	A0A8I6GBZ8_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
7	B2RYC7	1233	629	0.943	0.946	B2RYC7_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
8	F8W3B7	705	640	0.532	0.525	F8W3B7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=btk PE=3 SV=1
9	P24604	1221	630	0.940	0.941	TEC_MOUSE Tyrosine-protein kinase Tec OS=Mus musculus OX=10090 GN=Tec PE=1 SV=2
10	P35991	724	659	0.559	0.536	BTK_MOUSE Tyrosine-protein kinase BTK OS=Mus musculus OX=10090 GN=Btk PE=1 SV=4
11	P42680	1321	631	1.000	1.000	TEC_HUMAN Tyrosine-protein kinase Tec OS=Homo sapiens OX=9606 GN=TEC PE=1 SV=2
12	P42681	613	527	0.448	0.537	TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens OX=9606 GN=TXK PE=1 SV=3
13	P42682	611	527	0.439	0.526	TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus OX=10090 GN=Txk PE=1 SV=1
14	P51813	614	675	0.498	0.465	BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens OX=9606 GN=BMX PE=1 SV=1
15	Q03526	744	625	0.574	0.579	ITK_MOUSE Tyrosine-protein kinase ITK/TSK OS=Mus musculus OX=10090 GN=Itk PE=1 SV=1
16	Q06187	714	659	0.553	0.530	BTK_HUMAN Tyrosine-protein kinase BTK OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=3
17	Q08881	764	620	0.580	0.590	ITK_HUMAN Tyrosine-protein kinase ITK/TSK OS=Homo sapiens OX=9606 GN=ITK PE=1 SV=1
18	Q5S255	724	660	0.559	0.535	Q5S255_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=2 SV=1
19	Q8JH64	714	657	0.559	0.537	BTK_CHICK Tyrosine-protein kinase BTK OS=Gallus gallus OX=9031 GN=BTK PE=1 SV=1
20	U3NG26	610	568	0.480	0.533	U3NG26_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.9e+02	12.5	ABC1 atypical kinase-like domain
2	PF00779 BTK	2.3e-10	51.4	BTK motif
3	PF14531 Kinase-like	2.8e+02	12.2	Kinase-like
4	PF00169 PH	4.1e-12	57.9	PH domain
5	PF00069 Pkinase	3.1e-43	159.6	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	1.8e-91	317.6	Protein tyrosine and serine/threonine kinase
7	PF00017 SH2	6.3e-17	72.8	SH2 domain
8	PF00018 SH3_1	5.9e-11	53.1	SH3 domain
9	PF17902 SH3_10	98	14.4	SH3 domain
10	PF07653 SH3_2	0.35	22.0	Variant SH3 domain
11	PF14604 SH3_9	0.0054	28.0	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370912

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233668	0.982	Docking protein 1
2	9606.ENSP00000288135	0.966	Mast/stem cell growth factor receptor Kit
3	9606.ENSP00000371067	0.949	Tyrosine-protein kinase JAK2
4	9606.ENSP00000428924	0.949	Tyrosine-protein kinase Lyn
5	9606.ENSP00000376345	0.937	Growth factor receptor-bound protein 2
6	9606.ENSP00000472929	0.924	Proto-oncogene vav
7	9606.ENSP00000360916	0.910	Guanine nucleotide exchange factor VAV2
8	9606.ENSP00000222139	0.906	Erythropoietin receptor
9	9606.ENSP00000228280	0.902	Kit ligand
10	9606.ENSP00000252723	0.902	Erythropoietin
11	9606.ENSP00000483570	0.899	Tyrosine-protein kinase BTK
12	9606.ENSP00000224337	0.894	B-cell linker protein
13	9606.ENSP00000482457	0.883	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
14	9606.ENSP00000244007	0.877	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
15	9606.ENSP00000046794	0.840	Lymphocyte cytosolic protein 2
16	9606.ENSP00000359073	0.820	Guanine nucleotide exchange factor VAV3
17	9606.ENSP00000398655	0.803	Tyrosine-protein kinase ITK/TSK
18	9606.ENSP00000401303	0.777	SHC-transforming protein 1
19	9606.ENSP00000339186	0.657	GRB2-related adapter protein 2
20	9606.ENSP00000387784	0.633	Son of sevenless homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004713	0.998	protein tyrosine kinase activity
GO:0004715	0.785	non-membrane spanning protein tyrosine kinase activity
GO:0019901	0.407	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050896	0.981	response to stimulus
GO:0050789	0.973	regulation of biological process
GO:0050794	0.963	regulation of cellular process
GO:0048856	0.943	anatomical structure development
GO:0051716	0.922	cellular response to stimulus
GO:0023052	0.890	signaling
GO:0007154	0.888	cell communication
GO:0048518	0.853	positive regulation of biological process
GO:0007166	0.845	cell surface receptor signaling pathway
GO:0048583	0.815	regulation of response to stimulus
GO:0048584	0.650	positive regulation of response to stimulus
GO:0042246	0.611	tissue regeneration
GO:0044237	0.604	cellular metabolic process
GO:0071704	0.603	organic substance metabolic process
GO:0006793	0.556	phosphorus metabolic process
GO:0044238	0.554	primary metabolic process
GO:0006807	0.533	nitrogen compound metabolic process
GO:0048522	0.514	positive regulation of cellular process
GO:0043170	0.507	macromolecule metabolic process
GO:0006796	0.507	phosphate-containing compound metabolic process
GO:0035556	0.504	intracellular signal transduction
GO:0032501	0.500	multicellular organismal process
GO:1901564	0.495	organonitrogen compound metabolic process
GO:0019538	0.487	protein metabolic process
GO:0016310	0.473	phosphorylation
GO:0002376	0.460	immune system process
GO:0002764	0.455	immune response-regulating signaling pathway
GO:0002768	0.454	immune response-regulating cell surface receptor signaling pathway
GO:0050778	0.433	positive regulation of immune response
GO:0036211	0.418	protein modification process
GO:0019222	0.391	regulation of metabolic process
GO:0060255	0.374	regulation of macromolecule metabolic process
GO:0002429	0.361	immune response-activating cell surface receptor signaling pathway
GO:0051239	0.336	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0071944	0.987	cell periphery
GO:0005886	0.984	plasma membrane
GO:0043226	0.731	organelle
GO:0043231	0.701	intracellular membrane-bounded organelle
GO:0070161	0.372	anchoring junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.998	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.785	non-specific protein-tyrosine kinase.

[back to server]