StarFunc result for job id P42681

User Input

>input (527 residues)
MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSN
TGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH
LGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKA
INEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKG
KLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
EGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42681	1.000	1.000	1.808E-102	527	1.000	1.000	P42681.pdb.gz	TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens OX=9606 GN=TXK PE=1 SV=3
2	AFDB:P42682	0.835	0.835	7.796E-85	527	0.835	0.835	P42682.pdb.gz	TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus OX=10090 GN=Txk PE=1 SV=1
3	AFDB:Q03526	0.816	0.691	1.230E-64	625	0.514	0.434	Q03526.pdb.gz	ITK_MOUSE Tyrosine-protein kinase ITK/TSK OS=Mus musculus OX=10090 GN=Itk PE=1 SV=1
4	AFDB:A0A0G2KA94	0.807	0.637	2.094E-62	674	0.541	0.423	A0A0G2KA94.pdb.gz	A0A0G2KA94_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
5	AFDB:Q8JH64	0.794	0.641	4.718E-61	657	0.518	0.416	Q8JH64.pdb.gz	BTK_CHICK Tyrosine-protein kinase BTK OS=Gallus gallus OX=9031 GN=BTK PE=1 SV=1
6	AFDB:A0A0G2K134	0.802	0.644	4.199E-60	662	0.484	0.385	A0A0G2K134.pdb.gz	A0A0G2K134_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
7	AFDB:F8W3B7	0.699	0.583	1.548E-58	640	0.478	0.394	F8W3B7.pdb.gz	F8W3B7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=btk PE=3 SV=1
8	AFDB:P08630	0.763	0.523	9.779E-56	786	0.454	0.304	P08630.pdb.gz	BTKL_DROME Tyrosine-protein kinase Btk OS=Drosophila melanogaster OX=7227 GN=Btk PE=2 SV=2
9	AFDB:A0A0G2K6M9	0.736	0.706	2.220E-55	550	0.471	0.451	A0A0G2K6M9.pdb.gz	A0A0G2K6M9_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
10	AFDB:P00528	0.762	0.729	8.005E-51	552	0.347	0.332	P00528.pdb.gz	SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster OX=7227 GN=Src64B PE=1 SV=3
11	PDB:2h8hA	0.671	0.780	7.063E-43	445	0.328	0.389	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.486	0.577	2.729E-40	441	0.313	0.374	1k9aB.pdb.gz
13	PDB:4fl2A	0.453	0.432	3.694E-29	555	0.226	0.214	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.477	0.457	7.066E-28	551	0.231	0.221	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.407	0.728	6.524E-17	283	0.146	0.272	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:5ufuA	0.427	0.598	2.422E-16	369	0.116	0.165	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
17	PDB:2qkwB	0.406	0.699	2.701E-16	292	0.156	0.281	2qkwB.pdb.gz
18	PDB:4rerA	0.426	0.486	8.512E-16	459	0.118	0.135	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:1unlA	0.423	0.745	1.003E-15	292	0.110	0.199	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:4rewA	0.427	0.540	1.181E-15	411	0.114	0.146	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K6M9	0.0	576	661	0.512	0.408	A0A0G2K6M9_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
2	A0A0G2KA94	0.0	604	674	0.541	0.423	A0A0G2KA94_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
3	A0A8I5ZXG2	0.0	565	607	0.514	0.446	A0A8I5ZXG2_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
4	A0A8I6A3K6	0.0	577	681	0.520	0.402	A0A8I6A3K6_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
5	A0A8I6GBZ8	0.0	554	602	0.509	0.445	A0A8I6GBZ8_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
6	B2RYC7	0.0	604	629	0.541	0.453	B2RYC7_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
7	F8W3B7	0.0	538	640	0.478	0.394	F8W3B7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=btk PE=3 SV=1
8	P24604	0.0	605	630	0.541	0.452	TEC_MOUSE Tyrosine-protein kinase Tec OS=Mus musculus OX=10090 GN=Tec PE=1 SV=2
9	P35991	0.0	577	659	0.512	0.410	BTK_MOUSE Tyrosine-protein kinase BTK OS=Mus musculus OX=10090 GN=Btk PE=1 SV=4
10	P42680	0.0	614	631	0.554	0.463	TEC_HUMAN Tyrosine-protein kinase Tec OS=Homo sapiens OX=9606 GN=TEC PE=1 SV=2
11	P42681	0.0	1101	527	1.000	1.000	TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens OX=9606 GN=TXK PE=1 SV=3
12	P42682	0.0	896	527	0.833	0.833	TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus OX=10090 GN=Txk PE=1 SV=1
13	Q03526	0.0	562	625	0.526	0.443	ITK_MOUSE Tyrosine-protein kinase ITK/TSK OS=Mus musculus OX=10090 GN=Itk PE=1 SV=1
14	Q06187	0.0	573	659	0.499	0.399	BTK_HUMAN Tyrosine-protein kinase BTK OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=3
15	Q08881	0.0	570	620	0.535	0.455	ITK_HUMAN Tyrosine-protein kinase ITK/TSK OS=Homo sapiens OX=9606 GN=ITK PE=1 SV=1
16	Q5S255	0.0	576	660	0.512	0.409	Q5S255_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=2 SV=1
17	Q8JH64	0.0	572	657	0.518	0.416	BTK_CHICK Tyrosine-protein kinase BTK OS=Gallus gallus OX=9031 GN=BTK PE=1 SV=1
18	A0A0G2K134	1.21e-178	519	637	0.482	0.399	A0A0G2K134_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
19	P51813	3.46e-161	475	675	0.452	0.353	BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens OX=9606 GN=BMX PE=1 SV=1
20	U3NG26	7.51e-157	461	568	0.402	0.373	U3NG26_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	44	14.6	ABC1 atypical kinase-like domain
2	PF00069 Pkinase	3.6e-41	152.9	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	1.3e-90	314.8	Protein tyrosine and serine/threonine kinase
4	PF00017 SH2	3.2e-20	83.3	SH2 domain
5	PF00018 SH3_1	3.8e-09	47.3	SH3 domain
6	PF17902 SH3_10	3.1e+02	12.8	SH3 domain
7	PF07653 SH3_2	1e+02	14.1	Variant SH3 domain
8	PF14604 SH3_9	2.4e-05	35.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264316

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000046794	0.885	Lymphocyte cytosolic protein 2
2	9606.ENSP00000472929	0.850	Proto-oncogene vav
3	9606.ENSP00000398655	0.845	Tyrosine-protein kinase ITK/TSK
4	9606.ENSP00000360916	0.806	Guanine nucleotide exchange factor VAV2
5	9606.ENSP00000359073	0.803	Guanine nucleotide exchange factor VAV3
6	9606.ENSP00000339186	0.736	GRB2-related adapter protein 2
7	9606.ENSP00000428056	0.728	Phosphatidylinositol 3-kinase regulatory subunit alpha
8	9606.ENSP00000355759	0.722	Poly [ADP-ribose] polymerase 1
9	9606.ENSP00000244007	0.720	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
10	9606.ENSP00000376345	0.717	Growth factor receptor-bound protein 2
11	9606.ENSP00000378845	0.715	Linker for activation of T cells
12	9606.ENSP00000366563	0.710	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
13	9606.ENSP00000289153	0.690	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
14	9606.ENSP00000482457	0.685	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
15	9606.ENSP00000254037	0.682	Zinc finger CCHC domain-containing protein 9
16	9606.ENSP00000262741	0.678	Phosphatidylinositol 3-kinase regulatory subunit gamma
17	9606.ENSP00000263967	0.673	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
18	9606.ENSP00000401303	0.666	SHC-transforming protein 1
19	9606.ENSP00000359357	0.663	Zinc finger protein Gfi-1
20	9606.ENSP00000222254	0.658	Phosphatidylinositol 3-kinase regulatory subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0004715	0.638	non-membrane spanning protein tyrosine kinase activity
GO:0019899	0.550	enzyme binding
GO:0005102	0.515	signaling receptor binding
GO:0019900	0.394	kinase binding
GO:0019901	0.369	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.995	positive regulation of biological process
GO:0009987	0.993	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0050896	0.983	response to stimulus
GO:0010468	0.980	regulation of gene expression
GO:0051716	0.969	cellular response to stimulus
GO:0008152	0.945	metabolic process
GO:0007154	0.933	cell communication
GO:0023052	0.928	signaling
GO:0048522	0.916	positive regulation of cellular process
GO:0051239	0.868	regulation of multicellular organismal process
GO:0048583	0.861	regulation of response to stimulus
GO:0071704	0.853	organic substance metabolic process
GO:0007165	0.851	signal transduction
GO:0006796	0.848	phosphate-containing compound metabolic process
GO:0044238	0.845	primary metabolic process
GO:1901564	0.840	organonitrogen compound metabolic process
GO:0036211	0.830	protein modification process
GO:0050778	0.829	positive regulation of immune response
GO:0010604	0.806	positive regulation of macromolecule metabolic process
GO:0031323	0.790	regulation of cellular metabolic process
GO:0080090	0.782	regulation of primary metabolic process
GO:0051171	0.767	regulation of nitrogen compound metabolic process
GO:0032501	0.765	multicellular organismal process
GO:0007166	0.750	cell surface receptor signaling pathway
GO:0016310	0.701	phosphorylation
GO:0019219	0.696	regulation of nucleobase-containing compound metabolic process
GO:0051240	0.680	positive regulation of multicellular organismal process
GO:0002376	0.637	immune system process
GO:0032502	0.616	developmental process
GO:0010628	0.609	positive regulation of gene expression
GO:0048856	0.602	anatomical structure development
GO:0051173	0.524	positive regulation of nitrogen compound metabolic process
GO:0065009	0.520	regulation of molecular function
GO:0001819	0.509	positive regulation of cytokine production
GO:0048519	0.464	negative regulation of biological process
GO:0023051	0.446	regulation of signaling
GO:0010646	0.446	regulation of cell communication
GO:0002764	0.446	immune response-regulating signaling pathway
GO:0009966	0.442	regulation of signal transduction
GO:0031325	0.441	positive regulation of cellular metabolic process
GO:0048523	0.433	negative regulation of cellular process
GO:0006468	0.426	protein phosphorylation
GO:0009889	0.381	regulation of biosynthetic process
GO:0001775	0.361	cell activation
GO:0051252	0.341	regulation of RNA metabolic process
GO:0050790	0.332	regulation of catalytic activity
GO:0006355	0.332	regulation of DNA-templated transcription
GO:0023056	0.315	positive regulation of signaling
GO:0010647	0.315	positive regulation of cell communication
GO:0009967	0.313	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005829	0.955	cytosol
GO:0005634	0.935	nucleus
GO:0071944	0.769	cell periphery
GO:0016020	0.753	membrane
GO:0005886	0.736	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.638	non-specific protein-tyrosine kinase.

[back to server]