StarFunc result for job id P42684

User Input

>input (1182 residues)
MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHDHFASCVE
DGFEGDKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIV
TEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
NSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKR
NAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGG
SFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPR
SNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEES
AAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLG
MAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKL
LSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQE
GGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKIS
ADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAV
SKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42684	1.000	1.000	0.000	1182	1.000	1.000	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
2	AFDB:E9PT20	0.407	0.421	7.626E-98	1143	0.519	0.537	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
3	AFDB:A0A024R8E2	0.466	0.487	1.808E-97	1130	0.517	0.541	A0A024R8E2.pdb.gz
4	AFDB:F7BN18	0.462	0.483	2.250E-95	1128	0.509	0.534	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
5	PDB:2h8hA	0.336	0.837	4.759E-43	445	0.165	0.438	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
6	PDB:1k9aB	0.225	0.578	5.532E-40	441	0.148	0.397	1k9aB.pdb.gz
7	PDB:4fl2A	0.213	0.427	7.846E-31	555	0.127	0.270	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
8	PDB:4k2rA	0.221	0.452	3.779E-27	551	0.117	0.250	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
9	AFDB:P09208	0.212	0.120	2.460E-25	2144	0.195	0.108	P09208.pdb.gz	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
10	AFDB:A0A499FJ16	0.223	0.242	3.171E-25	1086	0.181	0.197	A0A499FJ16.pdb.gz	A0A499FJ16_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
11	AFDB:A0A0G2JUN9	0.205	0.224	7.387E-24	1077	0.175	0.192	A0A0G2JUN9.pdb.gz	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
12	AFDB:P80192	0.200	0.214	1.090E-22	1104	0.197	0.211	P80192.pdb.gz	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
13	AFDB:A0A0K3AV08	0.212	0.236	9.671E-22	1059	0.174	0.195	A0A0K3AV08.pdb.gz	MLK1_CAEEL Mitogen-activated protein kinase kinase kinase mlk-1 OS=Caenorhabditis elegans OX=6239 GN=mlk-1 PE=1 SV=1
14	AFDB:Q5TCX8	0.210	0.238	2.809E-21	1036	0.184	0.210	Q5TCX8.pdb.gz	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3
15	PDB:1unlA	0.201	0.765	2.814E-16	292	0.055	0.223	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
16	PDB:8dksA	0.185	0.711	4.444E-16	283	0.059	0.247	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
17	PDB:5u6yA	0.199	0.486	6.341E-16	459	0.061	0.157	5u6yA.pdb.gz
18	PDB:4krcA	0.198	0.730	1.751E-15	297	0.058	0.232	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
19	PDB:7myjC	0.199	0.485	1.751E-15	465	0.063	0.161	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
20	PDB:4zhxA	0.203	0.563	2.145E-15	409	0.060	0.174	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PT20	0.0	1074	1143	0.545	0.563	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
2	F7BN18	0.0	982	1128	0.432	0.453	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
3	P00519	0.0	976	1130	0.431	0.450	ABL1_HUMAN Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4
4	P00520	0.0	1001	1123	0.443	0.467	ABL1_MOUSE Tyrosine-protein kinase ABL1 OS=Mus musculus OX=10090 GN=Abl1 PE=1 SV=3
5	P00522	0.0	739	1620	0.287	0.209	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
6	P03949	0.0	599	1224	0.230	0.222	ABL1_CAEEL Tyrosine-protein kinase abl-1 OS=Caenorhabditis elegans OX=6239 GN=abl-1 PE=1 SV=4
7	P42684	0.0	2446	1182	1.000	1.000	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
8	Q2PYT4	0.0	1074	1143	0.545	0.563	Q2PYT4_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
9	Q4JIM5	0.0	2162	1182	0.943	0.943	ABL2_MOUSE Tyrosine-protein kinase ABL2 OS=Mus musculus OX=10090 GN=Abl2 PE=1 SV=1
10	Q9V9J3	5.34e-127	401	517	0.170	0.389	SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster OX=7227 GN=Src42A PE=1 SV=1
11	Q62662	3.59e-121	385	506	0.172	0.401	FRK_RAT Tyrosine-protein kinase FRK OS=Rattus norvegicus OX=10116 GN=Frk PE=1 SV=3
12	Q6EWH2	1.42e-119	382	537	0.172	0.378	FYNA_DANRE Tyrosine-protein kinase fyna OS=Danio rerio OX=7955 GN=fyna PE=1 SV=2
13	A1A5H8	1.69e-119	382	546	0.173	0.374	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
14	P42685	4.83e-118	377	505	0.169	0.396	FRK_HUMAN Tyrosine-protein kinase FRK OS=Homo sapiens OX=9606 GN=FRK PE=1 SV=1
15	F1NQU9	1.04e-117	377	534	0.170	0.376	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
16	F1RDG9	1.51e-117	377	544	0.168	0.366	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
17	P06241	2.05e-117	377	537	0.170	0.374	FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=3
18	P39688	2.32e-117	376	537	0.170	0.374	FYN_MOUSE Tyrosine-protein kinase Fyn OS=Mus musculus OX=10090 GN=Fyn PE=1 SV=4
19	P07947	2.46e-117	377	543	0.169	0.368	YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3
20	P09324	2.73e-117	376	541	0.168	0.368	YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus OX=9031 GN=YES1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	2.8e+02	12.0	ABC1 atypical kinase-like domain
2	PF08919 F_actin_bind	2e-27	106.9	F-actin binding
3	PF12330 Haspin_kinase	38	14.7	Haspin like kinase domain
4	PF15273 NHS	11	16.5	NHS-like
5	PF00069 Pkinase	1.5e-42	157.4	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	2.7e-94	326.9	Protein tyrosine and serine/threonine kinase
7	PF16613 RGS12_us1	3.6e+02	12.8	Unstructured region of RGS12
8	PF00017 SH2	6.6e-21	85.5	SH2 domain
9	PF00018 SH3_1	1.2e-08	45.7	SH3 domain
10	PF07653 SH3_2	0.00099	30.2	Variant SH3 domain
11	PF08239 SH3_3	0.27	23.0	Bacterial SH3 domain
12	PF12913 SH3_6	1.4e+02	13.5	SH3 domain (SH3b1 type)
13	PF14604 SH3_9	0.041	25.1	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427562

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300574	0.966	Adapter molecule crk
2	9606.ENSP00000359910	0.957	Proteasome subunit alpha type-7
3	9606.ENSP00000417273	0.955	Cytoplasmic protein NCK1
4	9606.ENSP00000310406	0.953	Ras and Rab interactor 1
5	9606.ENSP00000354251	0.952	Nck-associated protein 1
6	9606.ENSP00000361423	0.948	Tyrosine-protein kinase ABL1
7	9606.ENSP00000483313	0.933	Wiskott-Aldrich syndrome protein family member 2
8	9606.ENSP00000348461	0.926	Ras-related C3 botulinum toxin substrate 1
9	9606.ENSP00000369786	0.902	Pirin
10	9606.ENSP00000295851	0.884	Abl interactor 2
11	9606.ENSP00000355809	0.877	Protein enabled homolog
12	9606.ENSP00000249071	0.869	Ras-related C3 botulinum toxin substrate 2
13	9606.ENSP00000304283	0.866	Ras-related C3 botulinum toxin substrate 3
14	9606.ENSP00000346300	0.862	Crk-like protein
15	9606.ENSP00000365312	0.839	Abl interactor 1
16	9606.ENSP00000365745	0.818	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
17	9606.ENSP00000332773	0.814	Immunoglobulin superfamily DCC subclass member 3
18	9606.ENSP00000422591	0.796	Slit homolog 2 protein
19	9606.ENSP00000420321	0.791	Roundabout homolog 1
20	9606.ENSP00000241453	0.754	Receptor-type tyrosine-protein kinase FLT3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004713	0.999	protein tyrosine kinase activity
GO:0000287	0.998	magnesium ion binding
GO:0030145	0.998	manganese ion binding
GO:0001784	0.976	phosphotyrosine residue binding
GO:0003779	0.972	actin binding
GO:0004715	0.956	non-membrane spanning protein tyrosine kinase activity
GO:0044877	0.945	protein-containing complex binding
GO:0003785	0.939	actin monomer binding
GO:0051015	0.690	actin filament binding
GO:0005102	0.606	signaling receptor binding
GO:0019899	0.517	enzyme binding
GO:0097159	0.453	organic cyclic compound binding
GO:1901363	0.366	heterocyclic compound binding
GO:0097367	0.325	carbohydrate derivative binding
GO:0035639	0.323	purine ribonucleoside triphosphate binding
GO:0019901	0.321	protein kinase binding
GO:0032553	0.316	ribonucleotide binding
GO:0032555	0.314	purine ribonucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0051716	0.986	cellular response to stimulus
GO:0048522	0.986	positive regulation of cellular process
GO:0007154	0.983	cell communication
GO:0023052	0.981	signaling
GO:0071704	0.966	organic substance metabolic process
GO:0007165	0.965	signal transduction
GO:1901564	0.963	organonitrogen compound metabolic process
GO:0044238	0.962	primary metabolic process
GO:0043170	0.961	macromolecule metabolic process
GO:0044237	0.941	cellular metabolic process
GO:0032501	0.939	multicellular organismal process
GO:0019538	0.916	protein metabolic process
GO:0032502	0.915	developmental process
GO:0043412	0.908	macromolecule modification
GO:0051128	0.862	regulation of cellular component organization
GO:0018212	0.856	peptidyl-tyrosine modification
GO:0048856	0.855	anatomical structure development
GO:0071840	0.849	cellular component organization or biogenesis
GO:0006796	0.848	phosphate-containing compound metabolic process
GO:0016043	0.840	cellular component organization
GO:0048583	0.838	regulation of response to stimulus
GO:0018108	0.829	peptidyl-tyrosine phosphorylation
GO:0019222	0.825	regulation of metabolic process
GO:0030155	0.789	regulation of cell adhesion
GO:0010941	0.784	regulation of cell death
GO:0065009	0.768	regulation of molecular function
GO:0040012	0.754	regulation of locomotion
GO:0050790	0.746	regulation of catalytic activity
GO:0051493	0.731	regulation of cytoskeleton organization
GO:0048519	0.690	negative regulation of biological process
GO:0048523	0.675	negative regulation of cellular process
GO:0031323	0.672	regulation of cellular metabolic process
GO:0032970	0.666	regulation of actin filament-based process
GO:0009966	0.666	regulation of signal transduction
GO:0044093	0.640	positive regulation of molecular function
GO:0051130	0.631	positive regulation of cellular component organization
GO:0007166	0.607	cell surface receptor signaling pathway
GO:0007275	0.593	multicellular organism development
GO:0060255	0.541	regulation of macromolecule metabolic process
GO:2000145	0.517	regulation of cell motility
GO:0048731	0.503	system development
GO:0051336	0.489	regulation of hydrolase activity
GO:0032956	0.489	regulation of actin cytoskeleton organization
GO:0042221	0.483	response to chemical
GO:0060191	0.467	regulation of lipase activity
GO:1902531	0.449	regulation of intracellular signal transduction
GO:0007169	0.420	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0080090	0.411	regulation of primary metabolic process
GO:0051171	0.411	regulation of nitrogen compound metabolic process
GO:0043085	0.403	positive regulation of catalytic activity
GO:0031346	0.377	positive regulation of cell projection organization
GO:0120035	0.361	regulation of plasma membrane bounded cell projection organization
GO:0043067	0.359	regulation of programmed cell death
GO:0030334	0.358	regulation of cell migration
GO:0009893	0.353	positive regulation of metabolic process
GO:0010033	0.336	response to organic substance
GO:0032879	0.334	regulation of localization
GO:0030335	0.330	positive regulation of cell migration
GO:0050793	0.326	regulation of developmental process
GO:0065008	0.316	regulation of biological quality
GO:0048584	0.314	positive regulation of response to stimulus
GO:0010604	0.314	positive regulation of macromolecule metabolic process
GO:0051239	0.305	regulation of multicellular organismal process
GO:0031325	0.302	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0030054	0.991	cell junction
GO:0015629	0.988	actin cytoskeleton
GO:0005886	0.984	plasma membrane
GO:0005634	0.982	nucleus
GO:0070013	0.959	intracellular organelle lumen
GO:0031981	0.939	nuclear lumen
GO:0005654	0.903	nucleoplasm
GO:0031252	0.800	cell leading edge
GO:0031982	0.609	vesicle
GO:0045202	0.534	synapse
GO:0120025	0.516	plasma membrane bounded cell projection
GO:0012505	0.469	endomembrane system
GO:0043005	0.318	neuron projection
GO:0036477	0.307	somatodendritic compartment
GO:0098978	0.306	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.999	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.956	non-specific protein-tyrosine kinase.

[back to server]