StarFunc result for job id P42694

User Input

>input (1942 residues)
MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESL
LYRIASFLQLKNYVQADEDCRHVLGEGLAKGEDAFRAVLCCMQLKGKLQPVSTILAKSLT
GESLNGMVTKDLTRLKTLLSETETATSNALSGYHVEDLDEGSCNGWHFRPPPRGITSSEE
YTLCKRFLEQGICRYGAQCTSAHSQEELAEWQKRYASRLIKLKQQNENKQLSGSYMETLI
EKWMNSLSPEKVLSECIEGVKVEHNPDLSVTVSTKKSHQTWTFALTCKPARMLYRVALLY
DAHRPHFSIIAISAGDSTTQVSQEVPENCQEWIGGKMAQNGLDHYVYKVGIAFNTEIFGT
FRQTIVFDFGLEPVLMQRVMIDAASTEDLEYLMHAKQQLVTTAKRWDSSSKTIIDFEPNE
TTDLEKSLLIRYQIPLSADQLFTQSVLDKSLTKSNYQSRLHDLLYIEEIAQYKEISKFNL
KVQLQILASFMLTGVSGGAKYAQNGQLFGRFKLTETLSEDTLAGRLVMTKVNAVYLLPVP
KQKLVQTQGTKEKVYEATIEEKTKEYIFLRLSRECCEELNLRPDCDTQVELQFQLNRLPL
CEMHYALDRIKDNGVLFPDISMTPTIPWSPNRQWDEQLDPRLNAKQKEAVLAITTPLAIQ
LPPVLIIGPYGTGKTFTLAQAVKHILQQQETRILICTHSNSAADLYIKDYLHPYVEAGNP
QARPLRVYFRNRWVKTVHPVVHQYCLISSAHSTFQMPQKEDILKHRVVVVTLNTSQYLCQ
LDLEPGFFTHILLDEAAQAMECETIMPLALATQNTRIVLAGDHMQLSPFVYSEFARERNL
HVSLLDRLYEHYPAEFPCRILLCENYRSHEAIINYTSELFYEGKLMASGKQPAHKDFYPL
TFFTARGEDVQEKNSTAFYNNAEVFEVVERVEELRRKWPVAWGKLDDGSIGVVTPYADQV
FRIRAELRKKRLSDVNVERVLNVQGKQFRVLFLSTVRTRHTCKHKQTPIKKKEQLLEDST
EDLDYGFLSNYKLLNTAITRAQSLVAVVGDPIALCSIGRCRKFWERFIALCHENSSLHGI
TFEQIKAQLEALELKKTYVLNPLAPEFIPRALRLQHSGSTNKQQQSPPKGKSLHHTQNDH
FQNDGIVQPNPSVLIGNPIRAYTPPPPLGPHPNLGKSPSPVQRIDPHTGTSILYVPAVYG
GNVVMSVPLPVPWTGYQGRFAVDPRIITHQAAMAYNMNLLQTHGRGSPIPYGLGHHPPVT
IGQPQNQHQEKDQHEQNRNGKSDTNNSGPEINKIRTPEKKPTEPKQVDLESNPQNRSPES
RPSVVYPSTKFPRKDNLNPRHINLPLPAPHAQYAIPNRHFHPLPQLPRPPFPIPQQHTLL
NQQQNNLPEQPNQIPPQPNQVVQQQSQLNQQPQQPPPQLSPAYQAGPNNAFFNSAVAHRP
QSPPAEAVIPEQQPPPMLQEGHSPLRAIAQPGPILPSHLNSFIDENPSGLPIGEALDRIH
GSVALETLRQQQARFQQWSEHHAFLSQGSAPYPHHHHPHLQHLPQPPLGLHQPPVRADWK
LTSSAEDEVETTYSRFQDLIRELSHRDQSETRELAEMPPPQSRLLQYRQVQSRSPPAVPS
PPSSTDHSSHFSNFNDNSRDIEVASNPAFPQRLPPQIFNSPFSLPSEHLAPPPLKYLAPD
GAWTFANLQQNHLMGPGFPYGLPPLPHRPPQNPFVQIQNHQHAIGQEPFHPLSSRTVSSS
SLPSLEEYEPRGPGRPLYQRRISSSSVQPCSEEVSTPQDSLAQCKELQDHSNQSSFNFSS
PESWVNTTSSTPYQNIPCNGSSRTAQPRELIAPPKTVKPPEDQLKSENLEVSSSFNYSVL
QHLGQFPPLMPNKQIAESANSSSPQSSAGGKPAMSYASALRAPPKPRPPPEQAKKSSDPL
SLFQELSLGSSSGSNGFYSYFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42694	0.999	0.999	0.000	1942	1.000	1.000	P42694.pdb.gz	HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2
2	AFDB:Q6DFV5	0.587	0.580	0.000	1964	0.916	0.906	Q6DFV5.pdb.gz	HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus OX=10090 GN=Helz PE=1 SV=2
3	PDB:5eanA	0.218	0.371	2.631E-26	1051	0.066	0.123	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
4	PDB:4pj3A	0.190	0.264	8.587E-20	1335	0.064	0.093	4pj3A.pdb.gz	The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes.
5	PDB:3jb9X	0.197	0.303	3.428E-13	1195	0.052	0.085	3jb9X.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
6	PDB:3k70D	0.128	0.373	1.946E-10	547	0.043	0.152	3k70D.pdb.gz	DNA binding to RecD: role of the 1B domain in SF1B helicase activity.
7	PDB:5ld2D	0.131	0.369	7.965E-10	605	0.041	0.132	5ld2D.pdb.gz	Mechanism for nuclease regulation in RecBCD.
8	PDB:2is4B	0.122	0.341	7.024E-8	632	0.043	0.131	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
9	PDB:6qw65B	0.125	0.121	9.034E-8	2001	0.039	0.038	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
10	PDB:2is6A	0.133	0.362	1.351E-7	654	0.042	0.125	2is6A.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
11	PDB:7zelA	0.123	0.264	1.421E-7	827	0.043	0.100	7zelA.pdb.gz	Mechanistic understanding of human SLFN11.
12	PDB:1uaaA	0.130	0.366	2.734E-7	636	0.038	0.115	1uaaA.pdb.gz	Major domain swiveling revealed by the crystal structures of complexes of E. coli Rep helicase bound to single-stranded DNA and ADP.
13	AFDB:Q8IYD8	0.123	0.117	2.582E-5	2048	0.111	0.105	Q8IYD8.pdb.gz	FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
14	AFDB:Q54UZ8	0.127	0.107	3.911E-4	2373	0.098	0.080	Q54UZ8.pdb.gz	Q54UZ8_DICDI Myb domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280705 PE=4 SV=1
15	AFDB:A0A1D5NS76	0.042	0.041	6.075E-1	2005	0.089	0.086	A0A1D5NS76.pdb.gz
16	AFDB:A0A2R8QMK9	0.032	0.035	1.293	1689	0.078	0.089	A0A2R8QMK9.pdb.gz
17	AFDB:Q7TNC6	0.024	0.023	1.838	2112	0.075	0.069	Q7TNC6.pdb.gz	KI26B_MOUSE Kinesin-like protein KIF26B OS=Mus musculus OX=10090 GN=Kif26b PE=1 SV=3
18	AFDB:Q76I76	0.040	0.049	2.138	1423	0.082	0.112	Q76I76.pdb.gz	SSH2_HUMAN Protein phosphatase Slingshot homolog 2 OS=Homo sapiens OX=9606 GN=SSH2 PE=1 SV=1
19	AFDB:A0A2R8YDD6	0.025	0.039	3.198	892	0.078	0.170	A0A2R8YDD6.pdb.gz	A0A2R8YDD6_HUMAN Ataxin 7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
20	AFDB:A4D0Q3	0.020	0.042	3.537	759	0.070	0.178	A4D0Q3.pdb.gz	A4D0Q3_HUMAN KIAA1218 protein OS=Homo sapiens OX=9606 GN=KIAA1218 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P42694	0.0	4018	1942	1.000	1.000	HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2
2	Q6DFV5	0.0	3455	1964	0.916	0.905	HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus OX=10090 GN=Helz PE=1 SV=2
3	Q9BYK8	1.52e-135	474	2649	0.162	0.119	HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens OX=9606 GN=HELZ2 PE=1 SV=6
4	E9QAM5	2.25e-127	449	2947	0.163	0.107	HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus OX=10090 GN=Helz2 PE=1 SV=1
5	Q8GYD9	4.33e-55	213	1002	0.083	0.162	SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana OX=3702 GN=SDE3 PE=1 SV=1
6	Q99MV5	3.20e-49	195	1187	0.079	0.129	M10L1_MOUSE RNA helicase Mov10l1 OS=Mus musculus OX=10090 GN=Mov10l1 PE=1 SV=1
7	Q9BXT6	8.07e-49	194	1211	0.082	0.131	M10L1_HUMAN RNA helicase Mov10l1 OS=Homo sapiens OX=9606 GN=MOV10L1 PE=1 SV=1
8	D3ZUC2	9.15e-46	183	1074	0.081	0.147	D3ZUC2_RAT RNA helicase OS=Rattus norvegicus OX=10116 GN=Mov10 PE=3 SV=2
9	P23249	5.15e-45	181	1004	0.080	0.155	MOV10_MOUSE Putative helicase MOV-10 OS=Mus musculus OX=10090 GN=Mov10 PE=1 SV=2
10	Q5JR04	5.67e-45	180	947	0.080	0.165	Q5JR04_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=MOV10 PE=1 SV=1
11	Q9HCE1	1.09e-44	179	1003	0.080	0.156	MOV10_HUMAN Helicase MOV-10 OS=Homo sapiens OX=9606 GN=MOV10 PE=1 SV=2
12	A1Z9K0	1.12e-37	158	1333	0.071	0.103	A1Z9K0_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=EP(2)2054 PE=1 SV=2
13	Q8MQQ9	1.28e-37	157	1261	0.071	0.109	Q8MQQ9_DROME RNA helicase (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG6701 PE=2 SV=1
14	Q6J5K9	4.39e-35	149	1188	0.083	0.136	ARMI_DROME Probable RNA helicase armi OS=Drosophila melanogaster OX=7227 GN=armi PE=1 SV=4
15	A1ZAP7	1.10e-33	143	764	0.067	0.171	A1ZAP7_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=Mov10 PE=3 SV=2
16	Q09820	5.82e-28	125	925	0.073	0.154	RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf1 PE=3 SV=2
17	Q9FJR0	2.18e-27	124	1254	0.063	0.098	RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana OX=3702 GN=UPF1 PE=1 SV=2
18	Q9EPU0	6.43e-26	119	1124	0.070	0.120	RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus OX=10090 GN=Upf1 PE=1 SV=2
19	A0A024R7L5	1.03e-25	118	1118	0.068	0.118	A0A024R7L5_HUMAN UPF1 OS=Homo sapiens OX=9606 GN=UPF1 PE=2 SV=1
20	Q92900	1.40e-25	118	1129	0.068	0.117	RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13086 AAA_11	5.4e-22	90.4	AAA domain
2	PF13087 AAA_12	5.3e-31	119.3	AAA domain
3	PF13173 AAA_14	2e+02	13.4	AAA domain
4	PF13191 AAA_16	2.5e+02	13.4	AAA ATPase domain
5	PF13245 AAA_19	1.4e-05	36.8	AAA domain
6	PF13401 AAA_22	1.9e+02	13.7	AAA domain
7	PF13604 AAA_30	7.8e-06	37.3	AAA domain
8	PF07728 AAA_5	98	14.4	AAA domain (dynein-related subfamily)
9	PF12775 AAA_7	93	14.0	P-loop containing dynein motor region
10	PF00308 Bac_DnaA	8.9e+02	11.1	Bacterial dnaA protein
11	PF05127 Helicase_RecD	40	15.5	Helicase
12	PF07145 PAM2	0.59	21.0	Ataxin-2 C-terminal region
13	PF02562 PhoH	0.25	22.4	PhoH-like protein
14	PF04851 ResIII	0.43	22.1	Type III restriction enzyme, res subunit
15	PF00515 TPR_1	2.8e+02	12.8	Tetratricopeptide repeat
16	PF00580 UvrD-helicase	0.36	21.9	UvrD/REP helicase N-terminal domain
17	PF00642 zf-CCCH	0.00027	32.0	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
18	PF18044 zf-CCCH_4	12	17.1	CCCH-type zinc finger
19	PF18345 zf_CCCH_4	2.6	19.5	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351524

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419184	0.973	Histone-lysine N-methyltransferase SMYD3
2	9606.ENSP00000362774	0.845	Roquin-2
3	9606.ENSP00000258829	0.811	Homeobox protein Nkx-2.8
4	9606.ENSP00000356669	0.774	Roquin-1
5	9606.ENSP00000348168	0.747	Transcription initiation factor IIE subunit beta
6	9606.ENSP00000355924	0.731	N-lysine methyltransferase SMYD2
7	9606.ENSP00000216027	0.694	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
8	9606.ENSP00000356191	0.666	Opticin
9	9606.ENSP00000245552	0.665	5'(3')-deoxyribonucleotidase, cytosolic type
10	9606.ENSP00000344871	0.665	Unconventional myosin-If
11	9606.ENSP00000368688	0.663	Complex III assembly factor LYRM7
12	9606.ENSP00000288139	0.649	Voltage-dependent L-type calcium channel subunit alpha-1D
13	9606.ENSP00000300146	0.638	Protein PAT1 homolog 1
14	9606.ENSP00000320949	0.632	CCR4-NOT transcription complex subunit 1
15	9606.ENSP00000370345	0.630	PAN2-PAN3 deadenylation complex subunit PAN3
16	9606.ENSP00000464006	0.606	Cytoplasmic phosphatidylinositol transfer protein 1
17	9606.ENSP00000452762	0.597	Electron transfer flavoprotein subunit alpha, mitochondrial
18	9606.ENSP00000311135	0.592	Probable ATP-dependent RNA helicase DHX37
19	9606.ENSP00000313007	0.586	Polyadenylate-binding protein 1
20	9606.ENSP00000368397	0.580	LYR motif containing 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0050794	0.977	regulation of cellular process
GO:0044238	0.975	primary metabolic process
GO:0071704	0.974	organic substance metabolic process
GO:0010468	0.974	regulation of gene expression
GO:0006807	0.958	nitrogen compound metabolic process
GO:0043170	0.938	macromolecule metabolic process
GO:0048519	0.927	negative regulation of biological process
GO:0034641	0.852	cellular nitrogen compound metabolic process
GO:1901360	0.849	organic cyclic compound metabolic process
GO:0009892	0.847	negative regulation of metabolic process
GO:0006725	0.845	cellular aromatic compound metabolic process
GO:0090304	0.841	nucleic acid metabolic process
GO:0010605	0.713	negative regulation of macromolecule metabolic process
GO:0016070	0.691	RNA metabolic process
GO:0031323	0.578	regulation of cellular metabolic process
GO:0080090	0.500	regulation of primary metabolic process
GO:0051171	0.460	regulation of nitrogen compound metabolic process
GO:0010629	0.433	negative regulation of gene expression
GO:0010467	0.418	gene expression
GO:0051252	0.385	regulation of RNA metabolic process
GO:0010556	0.370	regulation of macromolecule biosynthetic process
GO:0031326	0.324	regulation of cellular biosynthetic process
GO:0048518	0.322	positive regulation of biological process
GO:0044260	0.305	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0005634	0.946	nucleus
GO:0005829	0.935	cytosol
GO:0070013	0.892	intracellular organelle lumen
GO:0031981	0.842	nuclear lumen
GO:0005654	0.691	nucleoplasm
GO:0032991	0.612	protein-containing complex
GO:0043228	0.456	non-membrane-bounded organelle
GO:0043232	0.454	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]