StarFunc result for job id P42695

User Input

>input (1498 residues)
MVALRGLGSGLQPWCPLDLRLEWVDTVWELDFTETEPLDPSIEAEIIETGLAAFTKLYES
LLPFATGEHGSMESIWTFFIENNVSHSTLVALFYHFVQIVHKKNVSVQYREYGLHAAGLY
FLLLEVPGSVANQVFHPVMFDKCIQTLKKSWPQESNLNRKRKKEQPKSSQANPGRHRKRG
KPPRREDIEMDEIIEEQEDENICFSARDLSQIRNAIFHLLKNFLRLLPKFSLKEKPQCVQ
NCIEVFVSLTNFEPVLHECHVTQARALNQAKYIPELAYYGLYLLCSPIHGEGDKVISCVF
HQMLSVILMLEVGEGSHRAPLAVTSQVINCRNQAVQFISALVDELKESIFPVVRILLQHI
CAKVVDKSEYRTFAAQSLVQLLSKLPCGEYAMFIAWLYKYSRSSKIPHRVFTLDVVLALL
ELPEREVDNTLSLEHQKFLKHKFLVQEIMFDRCLDKAPTVRSKALSSFAHCLELTVTSAS
ESILELLINSPTFSVIESHPGTLLRNSSAFSYQRQTSNRSEPSGEINIDSSGETVGSGER
CVMAMLRRRIRDEKTNVRKSALQVLVSILKHCDVSGMKEDLWILQDQCRDPAVSVRKQAL
QSLTELLMAQPRCVQIQKAWLRGVVPVVMDCESTVQEKALEFLDQLLLQNIRHHSHFHSG
DDSQVLAWALLTLLTTESQELSRYLNKAFHIWSKKEKFSPTFINNVISHTGTEHSAPAWM
LLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDA
VKCKLNGFQWSLEVISSAVDALQRLCRASAETPAEEQELLTQVCGDVLSTCEHRLSNIVL
KENGTGNMDEDLLVKYIFTLGDIAQLCPARVEKRIFLLIQSVLASSADADHSPSSQGSSE
APASQPPPQVRGSVMPSVIRAHAIITLGKLCLQHEDLAKKSIPALVRELEVCEDVAVRNN
VIIVMCDLCIRYTIMVDKYIPNISMCLKDSDPFIRKQTLILLTNLLQEEFVKWKGSLFFR
FVSTLIDSHPDIASFGEFCLAHLLLKRNPVMFFQHFIECIFHFNNYEKHEKYNKFPQSER
EKRLFSLKGKSNKERRMKIYKFLLEHFTDEQRFNITSKICLSILACFADGILPLDLDASE
LLSDTFEVLSSKEIKLLAMRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIEN
IIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQ
EQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRA
SAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTL
NSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAISTPEKSISDVTFGAGVSYIGTPRTPSS
AKEKIEGRSQGNDILCLSLPDKPPPQPQQWNVRSPARNKDTPACSRRSLRKTPLKTAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42695	1.000	1.000	0.000	1498	1.000	1.000	P42695.pdb.gz	CNDD3_HUMAN Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2
2	AFDB:Q6ZQK0	0.806	0.802	0.000	1506	0.740	0.736	Q6ZQK0.pdb.gz	CNDD3_MOUSE Condensin-2 complex subunit D3 OS=Mus musculus OX=10090 GN=Ncapd3 PE=1 SV=3
3	PDB:7qenD	0.430	0.587	2.239E-13	1050	0.111	0.158	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
4	PDB:7q2xD	0.418	0.600	6.877E-12	994	0.103	0.155	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
5	PDB:6zz6D	0.335	0.439	8.828E-12	1050	0.101	0.145	6zz6D.pdb.gz	Transport of DNA within cohesin involves clamping on top of engaged heads by Scc2 and entrapment within the ring by Scc3.
6	PDB:6xu2A	0.168	0.214	2.960E-9	1091	0.097	0.134	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
7	PDB:6yufD	0.344	0.390	5.238E-9	1272	0.111	0.131	6yufD.pdb.gz	A Structure-Based Mechanism for DNA Entry into the Cohesin Ring.
8	PDB:4a0cA	0.154	0.188	5.625E-9	1155	0.101	0.132	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
9	AFDB:Q6PR54	0.172	0.126	2.366E-8	2419	0.117	0.073	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
10	PDB:7wttK	0.158	0.214	2.517E-8	1022	0.087	0.128	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
11	AFDB:F4J8G7	0.112	0.088	2.930E-8	2138	0.148	0.103	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
12	PDB:3w3zA	0.187	0.254	6.834E-8	1013	0.096	0.142	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
13	PDB:4jlqA	0.167	0.267	7.882E-8	840	0.081	0.144	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
14	PDB:5oqrA	0.273	0.456	8.773E-8	751	0.080	0.160	5oqrA.pdb.gz
15	AFDB:Q5UIP0	0.157	0.114	3.315E-7	2472	0.107	0.065	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
16	AFDB:A0A096MKF8	0.130	0.103	1.381E-6	2190	0.137	0.094	A0A096MKF8.pdb.gz	A0A096MKF8_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1
17	AFDB:Q9VW83	0.135	0.119	2.533E-6	1847	0.120	0.097	Q9VW83.pdb.gz	Q9VW83_DROME Gigas, isoform A OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1
18	AFDB:G3X8Q1	0.118	0.092	5.254E-5	2187	0.128	0.088	G3X8Q1.pdb.gz	G3X8Q1_MOUSE Calcineurin binding protein 1 OS=Mus musculus OX=10090 GN=Cabin1 PE=1 SV=1
19	AFDB:O42900	0.156	0.140	5.643E-5	1706	0.081	0.072	O42900.pdb.gz	PPK19_SCHPO Serine/threonine-protein kinase ppk19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk19 PE=1 SV=1
20	AFDB:Q2TV84	0.074	0.069	1.427E-4	1622	0.096	0.089	Q2TV84.pdb.gz	TRPM1_MOUSE Transient receptor potential cation channel subfamily M member 1 OS=Mus musculus OX=10090 GN=Trpm1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P42695	0.0	3092	1498	1.000	1.000	CNDD3_HUMAN Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2
2	Q6GN08	0.0	1668	1492	0.582	0.584	CND3L_XENLA Condensin-2 complex subunit D3-L OS=Xenopus laevis OX=8355 GN=ncapd3.L PE=1 SV=1
3	Q6ZQK0	0.0	2187	1506	0.741	0.737	CNDD3_MOUSE Condensin-2 complex subunit D3 OS=Mus musculus OX=10090 GN=Ncapd3 PE=1 SV=3
4	Q96FA6	0.0	1152	558	0.372	1.000	Q96FA6_HUMAN NCAPD3 protein (Fragment) OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2
5	O24610	2.56e-78	287	1314	0.183	0.209	CNDD3_ARATH Condensin-2 complex subunit CAP-D3 OS=Arabidopsis thaliana OX=3702 GN=CAP-D3 PE=2 SV=2
6	Q95Y84	3.07e-37	156	1758	0.105	0.090	CND_CAEEL Condensin-2 complex subunit hcp-6 OS=Caenorhabditis elegans OX=6239 GN=hcp-6 PE=1 SV=1
7	Q8MSN8	1.38e-09	65.5	1001	0.069	0.104	Q8MSN8_DROME Condensin-2 complex subunit OS=Drosophila melanogaster OX=7227 GN=Cap-D3 PE=2 SV=1
8	Q8IGJ9	2.18e-09	65.1	1267	0.069	0.082	Q8IGJ9_DROME Condensin-2 complex subunit OS=Drosophila melanogaster OX=7227 GN=Cap-D3 PE=2 SV=1
9	Q9VMQ4	2.39e-09	64.7	1267	0.069	0.082	Q9VMQ4_DROME Condensin-2 complex subunit OS=Drosophila melanogaster OX=7227 GN=Cap-D3 PE=1 SV=2
10	Q8K2Z4	4.39e-08	60.8	1392	0.036	0.039	CND1_MOUSE Condensin complex subunit 1 OS=Mus musculus OX=10090 GN=Ncapd2 PE=1 SV=2
11	Q15021	1.64e-07	58.9	1401	0.025	0.027	CND1_HUMAN Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3
12	Q8SY09	1.55e-05	52.0	678	0.063	0.139	Q8SY09_DROME RE18364p OS=Drosophila melanogaster OX=7227 GN=Cap-D3 PE=2 SV=1
13	Q9YHY6	3.27e-05	51.2	1364	0.023	0.026	CND1_XENLA Condensin complex subunit 1 OS=Xenopus laevis OX=8355 GN=ncapd2 PE=1 SV=1
14	Q9U2M1	0.002	45.8	1499	0.014	0.014	CND1_CAEEL Condensin complex subunit 1 OS=Caenorhabditis elegans OX=6239 GN=dpy-28 PE=1 SV=2
15	O94679	0.018	42.4	1158	0.021	0.027	CND1_SCHPO Condensin complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnd1 PE=1 SV=1
16	A0A1I9LM04	0.021	42.0	1410	0.014	0.015	CNDD2_ARATH Condensin-1 complex subunit CAP-D2 OS=Arabidopsis thaliana OX=3702 GN=CAP-D2 PE=2 SV=1
17	F4J246	0.021	42.0	1415	0.014	0.015	F4J246_ARATH Condensin-1 complex subunit CAP-D2 OS=Arabidopsis thaliana OX=3702 GN=At3g57060 PE=1 SV=1
18	Q06156	0.047	40.8	1176	0.040	0.051	CND1_YEAST Condensin complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCS4 PE=1 SV=1
19	A0A8I6ARN7	0.35	38.1	1579	0.021	0.020	A0A8I6ARN7_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1
20	E9PTG1	0.36	38.1	1597	0.021	0.019	E9PTG1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	0.06	23.5	Adaptin N terminal region
2	PF12348 CLASP_N	1.1	20.4	CLASP N terminal
3	PF12717 Cnd1	1.4e-30	117.9	non-SMC mitotic condensation complex subunit 1
4	PF12719 Cnd3	0.91	20.3	Nuclear condensing complex subunits, C-term domain
5	PF12765 Cohesin_HEAT	40	15.9	HEAT repeat associated with sister chromatid cohesion
6	PF11217 DUF3013	8.1	17.7	Protein of unknown function (DUF3013)
7	PF02985 HEAT	8.1e-06	36.7	HEAT repeat
8	PF13646 HEAT_2	0.00026	32.7	HEAT repeats
9	PF18808 Importin_rep_4	8.7e+02	11.7	Importin repeat
10	PF10363 RTP1_C1	2.2e+02	13.4	Required for nuclear transport of RNA pol II C-terminus 1
11	PF00790 VHS	63	14.9	VHS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000433681

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286398	0.999	Structural maintenance of chromosomes protein 2
2	9606.ENSP00000299821	0.999	Condensin-2 complex subunit H2
3	9606.ENSP00000349961	0.999	Structural maintenance of chromosomes protein 4
4	9606.ENSP00000387007	0.999	Condensin-2 complex subunit G2
5	9606.ENSP00000240423	0.998	Condensin complex subunit 2
6	9606.ENSP00000251496	0.997	Condensin complex subunit 3
7	9606.ENSP00000378699	0.990	Cyclin-dependent kinase 1
8	9606.ENSP00000325017	0.984	Condensin complex subunit 1
9	9606.ENSP00000256442	0.939	G2/mitotic-specific cyclin-B1
10	9606.ENSP00000260731	0.937	Kinesin-like protein KIF11
11	9606.ENSP00000300093	0.928	Serine/threonine-protein kinase PLK1
12	9606.ENSP00000267163	0.914	Retinoblastoma-associated protein
13	9606.ENSP00000350676	0.908	Histone lysine demethylase PHF8
14	9606.ENSP00000261597	0.907	Kinetochore protein NDC80 homolog
15	9606.ENSP00000356379	0.883	Abnormal spindle-like microcephaly-associated protein
16	9606.ENSP00000358813	0.883	Dual specificity protein kinase TTK
17	9606.ENSP00000265148	0.878	Centromere-associated protein E
18	9606.ENSP00000296509	0.873	Mitotic spindle assembly checkpoint protein MAD2A
19	9606.ENSP00000302530	0.867	Mitotic checkpoint serine/threonine-protein kinase BUB1
20	9606.ENSP00000354957	0.852	Structural maintenance of chromosomes protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	0.998	methylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0051276	0.988	chromosome organization
GO:0000278	0.983	mitotic cell cycle
GO:1903047	0.965	mitotic cell cycle process
GO:0000819	0.961	sister chromatid segregation
GO:0140014	0.961	mitotic nuclear division
GO:0000070	0.933	mitotic sister chromatid segregation
GO:0050789	0.856	regulation of biological process
GO:0050794	0.820	regulation of cellular process
GO:0030261	0.585	chromosome condensation
GO:0048518	0.442	positive regulation of biological process
GO:0048522	0.411	positive regulation of cellular process
GO:0010564	0.341	regulation of cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000775	0.999	chromosome, centromeric region
GO:0000796	0.999	condensin complex
GO:0005654	0.997	nucleoplasm
GO:0016020	0.987	membrane
GO:0005829	0.940	cytosol
GO:0000785	0.696	chromatin
GO:0000792	0.427	heterochromatin
GO:0005721	0.335	pericentric heterochromatin
GO:0000793	0.314	condensed chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]