StarFunc result for job id P42701

User Input

>input (662 residues)
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRY
ECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWAR
NQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSP
WKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQ
VRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRT
LHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPA
RAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFA
SAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKE
YVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE
VQVSDWLIFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQ
WINPVDFQEEASLQEALVVEMSWDKGERTEPLEKTELPEGAPELALDTELSLEDGDRCKA
KM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42701	1.000	1.000	0.000	662	1.000	1.000	P42701.pdb.gz	I12R1_HUMAN Interleukin-12 receptor subunit beta-1 OS=Homo sapiens OX=9606 GN=IL12RB1 PE=1 SV=1
2	AFDB:Q60837	0.717	0.653	5.634E-68	738	0.533	0.478	Q60837.pdb.gz	I12R1_MOUSE Interleukin-12 receptor subunit beta-1 OS=Mus musculus OX=10090 GN=Il12rb1 PE=1 SV=2
3	AFDB:Q8NI17	0.238	0.218	5.058E-29	732	0.202	0.183	Q8NI17.pdb.gz	IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL31RA PE=1 SV=1
4	AFDB:Q8K5B1	0.244	0.230	1.643E-28	716	0.187	0.173	Q8K5B1.pdb.gz	IL31R_MOUSE Interleukin-31 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il31ra PE=1 SV=3
5	AFDB:A8WH79	0.240	0.196	5.199E-25	866	0.166	0.127	A8WH79.pdb.gz	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
6	AFDB:Q99650	0.252	0.185	1.006E-24	979	0.168	0.113	Q99650.pdb.gz	OSMR_HUMAN Oncostatin-M-specific receptor subunit beta OS=Homo sapiens OX=9606 GN=OSMR PE=1 SV=1
7	AFDB:Q99062	0.274	0.229	1.273E-24	836	0.162	0.128	Q99062.pdb.gz	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
8	AFDB:Q99665	0.255	0.208	4.764E-24	862	0.177	0.136	Q99665.pdb.gz	I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
9	AFDB:A8Y5W0	0.222	0.190	6.627E-24	810	0.157	0.128	A8Y5W0.pdb.gz	A8Y5W0_DANRE Granulocyte colony-stimulating factor receptor OS=Danio rerio OX=7955 GN=gcsfr PE=2 SV=1
10	AFDB:P97378	0.237	0.194	6.365E-23	874	0.157	0.119	P97378.pdb.gz	I12R2_MOUSE Interleukin-12 receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Il12rb2 PE=1 SV=1
11	PDB:7q5zA	0.138	0.083	7.949E-9	1344	0.068	0.033	7q5zA.pdb.gz
12	PDB:4rtdA	0.124	0.086	1.055E-8	1122	0.088	0.052	4rtdA.pdb.gz
13	PDB:7q1yA	0.133	0.087	2.582E-8	1374	0.069	0.033	7q1yA.pdb.gz
14	PDB:8eyyA	0.179	0.157	2.975E-8	775	0.071	0.061	8eyyA.pdb.gz
15	PDB:8dtlA	0.171	0.155	3.269E-8	741	0.069	0.062	8dtlA.pdb.gz
16	PDB:6pxvA	0.177	0.147	1.013E-7	823	0.080	0.064	6pxvA.pdb.gz
17	PDB:6pyhD	0.172	0.147	1.409E-7	798	0.088	0.073	6pyhD.pdb.gz
18	PDB:6h03A	0.130	0.079	1.960E-7	1223	0.079	0.043	6h03A.pdb.gz
19	PDB:4ziqA	0.118	0.066	6.674E-7	1450	0.098	0.045	4ziqA.pdb.gz
20	PDB:5oj2B	0.205	0.199	1.121E-6	692	0.098	0.094	5oj2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PSU7	0.0	640	738	0.523	0.469	E9PSU7_RAT Interleukin 12 receptor subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Il12rb1 PE=4 SV=2
2	P42701	0.0	1365	662	1.000	1.000	I12R1_HUMAN Interleukin-12 receptor subunit beta-1 OS=Homo sapiens OX=9606 GN=IL12RB1 PE=1 SV=1
3	Q60837	0.0	647	738	0.536	0.481	I12R1_MOUSE Interleukin-12 receptor subunit beta-1 OS=Mus musculus OX=10090 GN=Il12rb1 PE=1 SV=2
4	A0A8I5ZPZ3	1.35e-175	517	668	0.420	0.416	A0A8I5ZPZ3_RAT Interleukin 12 receptor subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Il12rb1 PE=4 SV=1
5	Q90Z70	1.08e-05	51.2	1513	0.057	0.025	Q90Z70_DANRE Robo2 OS=Danio rerio OX=7955 GN=sb:eu937 PE=2 SV=1
6	A0A8I6A6R5	2.27e-05	50.4	1920	0.044	0.015	A0A8I6A6R5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
7	A0A8I6AEM0	2.29e-05	50.4	1897	0.044	0.015	A0A8I6AEM0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
8	A0A8I6A1V1	2.41e-05	50.4	1912	0.044	0.015	A0A8I6A1V1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
9	M0RB22	2.45e-05	50.4	1899	0.044	0.015	M0RB22_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=3
10	F1M950	2.62e-05	50.1	1533	0.059	0.025	F1M950_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=4
11	A0A0G2JZA1	2.67e-05	50.1	1472	0.059	0.026	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
12	A0A1W2Q6F3	2.72e-05	50.1	1512	0.059	0.026	A0A1W2Q6F3_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
13	A0A8I6A1P7	2.76e-05	50.1	1377	0.059	0.028	A0A8I6A1P7_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=1
14	A0A8I6AKD6	2.80e-05	50.1	1381	0.059	0.028	A0A8I6AKD6_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=1
15	Q9QZI3	3.39e-05	49.7	1060	0.059	0.037	Q9QZI3_RAT Robo2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Robo2 PE=2 SV=1
16	A0A024B7I3	3.76e-05	49.7	1206	0.057	0.032	A0A024B7I3_CHICK Roundabout-like protein 2 OS=Gallus gallus OX=9031 GN=ROBO2 PE=2 SV=1
17	Q64487	3.94e-05	49.7	1912	0.044	0.015	PTPRD_MOUSE Receptor-type tyrosine-protein phosphatase delta OS=Mus musculus OX=10090 GN=Ptprd PE=1 SV=3
18	Q7TPD3	1.10e-04	48.1	1470	0.057	0.026	ROBO2_MOUSE Roundabout homolog 2 OS=Mus musculus OX=10090 GN=Robo2 PE=1 SV=2
19	Q8K5B1	3.38e-04	46.2	716	0.189	0.175	IL31R_MOUSE Interleukin-31 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il31ra PE=1 SV=3
20	A8WH93	5.39e-04	45.1	362	0.063	0.116	A8WH93_DANRE Interleukin 2 receptor gamma common.a OS=Danio rerio OX=7955 GN=il-2rgc.a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	1.9e-09	49.1	Fibronectin type III domain
2	PF16656 Pur_ac_phosph_N	1.6	20.7	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000470788

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321345	0.999	Interleukin-23 receptor
2	9606.ENSP00000262345	0.998	Interleukin-12 receptor subunit beta-2
3	9606.ENSP00000431885	0.998	Non-receptor tyrosine-protein kinase TYK2
4	9606.ENSP00000371067	0.995	Tyrosine-protein kinase JAK2
5	9606.ENSP00000228534	0.992	Interleukin-23 subunit alpha
6	9606.ENSP00000231228	0.976	Interleukin-12 subunit beta
7	9606.ENSP00000376134	0.976	Signal transducer and activator of transcription 4
8	9606.ENSP00000245222	0.969	Sphingosine kinase 2
9	9606.ENSP00000303231	0.967	Interleukin-12 subunit alpha
10	9606.ENSP00000354394	0.967	Signal transducer and activator of transcription 1-alpha/beta
11	9606.ENSP00000264657	0.964	Signal transducer and activator of transcription 3
12	9606.ENSP00000231449	0.958	Interleukin-4
13	9606.ENSP00000263341	0.956	Interleukin-1 beta
14	9606.ENSP00000330341	0.946	Suppressor of cytokine signaling 3
15	9606.ENSP00000341208	0.946	Signal transducer and activator of transcription 5A
16	9606.ENSP00000300134	0.945	Signal transducer and activator of transcription 6
17	9606.ENSP00000329418	0.931	Suppressor of cytokine signaling 1
18	9606.ENSP00000327251	0.929	Nitric oxide synthase, inducible
19	9606.ENSP00000337825	0.926	Tyrosine-protein kinase Lck
20	9606.ENSP00000226574	0.920	Nuclear factor NF-kappa-B p105 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070851	1.000	growth factor receptor binding
GO:0005126	1.000	cytokine receptor binding
GO:0004896	1.000	cytokine receptor activity
GO:0019955	0.995	cytokine binding
GO:0042019	0.347	interleukin-23 binding
GO:0042020	0.347	interleukin-23 receptor activity
GO:0016517	0.345	interleukin-12 receptor activity
GO:0005143	0.317	interleukin-12 receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0042127	0.990	regulation of cell population proliferation
GO:0051716	0.988	cellular response to stimulus
GO:0050870	0.988	positive regulation of T cell activation
GO:0019222	0.985	regulation of metabolic process
GO:0032101	0.983	regulation of response to external stimulus
GO:0010468	0.983	regulation of gene expression
GO:0010604	0.982	positive regulation of macromolecule metabolic process
GO:0009967	0.979	positive regulation of signal transduction
GO:0050671	0.977	positive regulation of lymphocyte proliferation
GO:0042129	0.975	regulation of T cell proliferation
GO:0042102	0.973	positive regulation of T cell proliferation
GO:0046427	0.959	positive regulation of receptor signaling pathway via JAK-STAT
GO:0019221	0.951	cytokine-mediated signaling pathway
GO:0001819	0.947	positive regulation of cytokine production
GO:0002376	0.943	immune system process
GO:0006950	0.936	response to stress
GO:0002831	0.935	regulation of response to biotic stimulus
GO:0006955	0.929	immune response
GO:0050776	0.919	regulation of immune response
GO:0006952	0.915	defense response
GO:0031347	0.913	regulation of defense response
GO:0051707	0.900	response to other organism
GO:0002819	0.894	regulation of adaptive immune response
GO:0032816	0.892	positive regulation of natural killer cell activation
GO:0002822	0.853	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0032649	0.838	regulation of type II interferon production
GO:0032729	0.831	positive regulation of type II interferon production
GO:0046634	0.814	regulation of alpha-beta T cell activation
GO:0098542	0.729	defense response to other organism
GO:0031323	0.728	regulation of cellular metabolic process
GO:0050778	0.727	positive regulation of immune response
GO:0048519	0.684	negative regulation of biological process
GO:0050688	0.515	regulation of defense response to virus
GO:0031325	0.439	positive regulation of cellular metabolic process
GO:0051171	0.419	regulation of nitrogen compound metabolic process
GO:0046635	0.413	positive regulation of alpha-beta T cell activation
GO:0002821	0.412	positive regulation of adaptive immune response
GO:0080090	0.402	regulation of primary metabolic process
GO:0032501	0.396	multicellular organismal process
GO:0050691	0.375	regulation of defense response to virus by host
GO:0045087	0.370	innate immune response
GO:0051173	0.368	positive regulation of nitrogen compound metabolic process
GO:0002824	0.348	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0046640	0.343	regulation of alpha-beta T cell proliferation
GO:0048523	0.339	negative regulation of cellular process
GO:0046006	0.329	regulation of activated T cell proliferation
GO:0002230	0.327	positive regulation of defense response to virus by host

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098802	0.998	plasma membrane signaling receptor complex
GO:0072536	0.724	interleukin-23 receptor complex
GO:0005622	0.616	intracellular anatomical structure
GO:0043226	0.613	organelle
GO:0043227	0.599	membrane-bounded organelle
GO:0043229	0.576	intracellular organelle
GO:0005737	0.575	cytoplasm
GO:0042022	0.465	interleukin-12 receptor complex
GO:0005576	0.426	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]