StarFunc result for job id P42702

User Input

>input (1097 residues)
MMDIYVCLKRPSWMVDNKRMRTASNFQWLLSTFILLYLMNQVNSQKKGAPHDLKCVTNNL
QVWNCSWKAPSGTGRGTDYEVCIENRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGS
STSKFTLNEQNVSLIPDTPEILNLSADFSTSTLYLKWNDRGSVFPHRSNVIWEIKVLRKE
SMELVKLVTHNTTLNGKDTLHHWSWASDMPLECAIHFVEIRCYIDNLHFSGLEEWSDWSP
VKNISWIPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSALIGHTNCPLIHLDGENVAIK
IRNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETHDLKEIICSWNPGRVTA
LVGPRATSYTLVESFSGKYVRLKRAEAPTNESYQLLFQMLPNQEIYNFTLNAHNPLGRSQ
STILVNITEKVYPHTPTSFKVKDINSTAVKLSWHLPGNFAKINFLCEIEIKKSNSVQEQR
NVTIKGVENSSYLVALDKLNPYTLYTFRIRCSTETFWKWSKWSNKKQHLTTEASPSKGPD
TWREWSSDGKNLIIYWKPLPINEANGKILSYNVSCSSDEETQSLSEIPDPQHKAEIRLDK
NDYIISVVAKNSVGSSPPSKIASMEIPNDDLKIEQVVGMGKGILLTWHYDPNMTCDYVIK
WCNSSRSEPCLMDWRKVPSNSTETVIESDEFRPGIRYNFFLYGCRNQGYQLLRSMIGYIE
ELAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFGKGERDTSKMRVLESGR
SDIKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGVGPEKSMYVVTKENSVGLIIAI
LIPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLEM
NPCTPNNVEVLETRSAFPKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPIIEEEIPN
PAADEAGGTAQVIYIDVQSMYQPQAKPEEEQENDPVGGAGYKPQMHLPINSTVEDIAAEE
DLDKTAGYRPQANVNTWNLVSPDSPRSIDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKS
NGGGWSFTNFFQNKPND

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70535	0.789	0.791	0.000	1093	0.740	0.743	O70535.pdb.gz	LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus norvegicus OX=10116 GN=Lifr PE=2 SV=1
2	AFDB:P42702	1.000	1.000	0.000	1097	1.000	1.000	P42702.pdb.gz	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1
3	AFDB:F1NDH9	0.223	0.215	5.492E-38	1148	0.162	0.155	F1NDH9.pdb.gz
4	AFDB:R9QT79	0.182	0.177	2.236E-33	1132	0.153	0.148	R9QT79.pdb.gz	R9QT79_ONCMY Long-form leptin receptor OS=Oncorhynchus mykiss OX=8022 GN=LepR PE=2 SV=1
5	AFDB:Q59FP8	0.145	0.142	6.228E-33	1130	0.143	0.139	Q59FP8.pdb.gz	Q59FP8_HUMAN Neogenin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=1
6	AFDB:Q9VPZ7	0.121	0.102	8.881E-30	1342	0.169	0.138	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
7	AFDB:A0A0R4IAW3	0.153	0.174	2.077E-23	898	0.108	0.133	A0A0R4IAW3.pdb.gz
8	AFDB:Q9VQW7	0.108	0.092	1.011E-22	1332	0.123	0.101	Q9VQW7.pdb.gz	Q9VQW7_DROME Echinoid, isoform A OS=Drosophila melanogaster OX=7227 GN=ed PE=1 SV=2
9	AFDB:Q0KIB0	0.148	0.107	5.871E-15	1689	0.104	0.067	Q0KIB0.pdb.gz	Q0KIB0_DROME Sidestep III, isoform O OS=Drosophila melanogaster OX=7227 GN=side-III PE=1 SV=1
10	PDB:7q5zA	0.089	0.079	1.099E-14	1344	0.068	0.056	7q5zA.pdb.gz
11	PDB:5oj2B	0.090	0.124	3.207E-14	692	0.087	0.137	5oj2B.pdb.gz
12	PDB:7q1yA	0.091	0.075	3.864E-14	1374	0.060	0.048	7q1yA.pdb.gz
13	PDB:1e07A	0.140	0.207	1.005E-12	642	0.074	0.126	1e07A.pdb.gz
14	AFDB:A0A2R8RMH2	0.089	0.086	1.241E-12	1150	0.111	0.106	A0A2R8RMH2.pdb.gz
15	PDB:5a42A	0.083	0.063	5.128E-12	1597	0.080	0.055	5a42A.pdb.gz
16	PDB:6h03A	0.093	0.086	2.275E-11	1223	0.067	0.061	6h03A.pdb.gz
17	PDB:4lnvA	0.114	0.101	3.008E-11	1276	0.067	0.058	4lnvA.pdb.gz
18	PDB:4ziqA	0.101	0.083	3.151E-11	1450	0.079	0.060	4ziqA.pdb.gz
19	PDB:7nycA	0.089	0.069	4.791E-11	1542	0.065	0.046	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:8dtlA	0.117	0.159	1.607E-10	741	0.060	0.089	8dtlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70535	0.0	1670	1093	0.741	0.744	LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus norvegicus OX=10116 GN=Lifr PE=2 SV=1
2	P42702	0.0	2271	1097	1.000	1.000	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1
3	P42703	0.0	1691	1092	0.752	0.755	LIFR_MOUSE Leukemia inhibitory factor receptor OS=Mus musculus OX=10090 GN=Lifr PE=1 SV=1
4	Q99650	8.08e-123	403	979	0.247	0.277	OSMR_HUMAN Oncostatin-M-specific receptor subunit beta OS=Homo sapiens OX=9606 GN=OSMR PE=1 SV=1
5	O70458	8.83e-109	364	971	0.234	0.265	OSMR_MOUSE Oncostatin-M-specific receptor subunit beta OS=Mus musculus OX=10090 GN=Osmr PE=1 SV=1
6	Q00560	5.02e-50	194	917	0.149	0.179	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
7	P40190	5.02e-49	191	918	0.156	0.186	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
8	Q17RA0	1.27e-45	180	918	0.155	0.185	Q17RA0_HUMAN Interleukin 6 signal transducer (Gp130, oncostatin M receptor) OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=1
9	P40189	1.67e-45	180	918	0.155	0.185	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
10	F1RCZ2	7.69e-32	136	859	0.138	0.176	F1RCZ2_DANRE Interleukin 6 cytokine family signal transduce OS=Danio rerio OX=7955 GN=gp130 PE=4 SV=2
11	F1R904	3.25e-26	118	810	0.142	0.193	F1R904_DANRE Colony-stimulating factor 3 receptor (granulocyte) OS=Danio rerio OX=7955 GN=gcsfr PE=3 SV=1
12	Q99665	5.92e-26	117	862	0.139	0.177	I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
13	Q8NI17	1.00e-25	116	732	0.120	0.180	IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL31RA PE=1 SV=1
14	A8Y5W0	6.22e-25	114	810	0.140	0.190	A8Y5W0_DANRE Granulocyte colony-stimulating factor receptor OS=Danio rerio OX=7955 GN=gcsfr PE=2 SV=1
15	F1LRH7	1.02e-24	114	869	0.128	0.161	F1LRH7_RAT Interleukin 12 receptor subunit beta 2 OS=Rattus norvegicus OX=10116 GN=Il12rb2 PE=3 SV=2
16	A8WH79	6.13e-24	111	866	0.133	0.169	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
17	P97378	8.20e-23	107	874	0.128	0.160	I12R2_MOUSE Interleukin-12 receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Il12rb2 PE=1 SV=1
18	Q99062	3.24e-20	99.4	836	0.121	0.159	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
19	Q8K5B1	4.31e-18	92.0	716	0.113	0.173	IL31R_MOUSE Interleukin-31 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il31ra PE=1 SV=3
20	P40223	4.34e-18	92.4	837	0.121	0.159	CSF3R_MOUSE Granulocyte colony-stimulating factor receptor OS=Mus musculus OX=10090 GN=Csf3r PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12877 DUF3827	5.1e+02	10.4	Domain of unknown function (DUF3827)
2	PF09067 EpoR_lig-bind	0.036	25.6	Erythropoietin receptor, ligand binding
3	PF00041 fn3	9.1e-19	78.9	Fibronectin type III domain
4	PF09240 IL6Ra-bind	21	17.0	Interleukin-6 receptor alpha chain, binding
5	PF17971 LIFR_D2	3.2e-53	190.1	Leukemia inhibitory factor receptor D2 domain
6	PF18207 LIFR_N	8.2e-34	127.0	Leukemia inhibitory factor receptor N-terminal domain
7	PF16656 Pur_ac_phosph_N	0.17	23.9	Purple acid Phosphatase, N-terminal domain
8	PF15102 TMEM154	2.7e+02	12.8	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263409

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215781	0.999	Oncostatin-M
2	9606.ENSP00000355370	0.999	Ciliary neurotrophic factor
3	9606.ENSP00000368265	0.998	Ciliary neurotrophic factor receptor subunit alpha
4	9606.ENSP00000249075	0.993	Leukemia inhibitory factor
5	9606.ENSP00000279804	0.983	Cardiotrophin-1
6	9606.ENSP00000370698	0.941	Interleukin-6 receptor subunit beta
7	9606.ENSP00000385675	0.932	Interleukin-6
8	9606.ENSP00000309338	0.913	Cardiotrophin-like cytokine factor 1
9	9606.ENSP00000343204	0.910	Tyrosine-protein kinase JAK1
10	9606.ENSP00000300305	0.900	Runt-related transcription factor 1
11	9606.ENSP00000415151	0.900	Core-binding factor subunit beta
12	9606.ENSP00000371067	0.887	Tyrosine-protein kinase JAK2
13	9606.ENSP00000264563	0.865	Interleukin-11
14	9606.ENSP00000391676	0.852	Tyrosine-protein kinase JAK3
15	9606.ENSP00000376345	0.831	Growth factor receptor-bound protein 2
16	9606.ENSP00000264657	0.772	Signal transducer and activator of transcription 3
17	9606.ENSP00000276927	0.769	Interferon alpha-1/13
18	9606.ENSP00000265171	0.758	Pro-epidermal growth factor
19	9606.ENSP00000431885	0.718	Non-receptor tyrosine-protein kinase TYK2
20	9606.ENSP00000225474	0.715	Granulocyte colony-stimulating factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004896	1.000	cytokine receptor activity
GO:0005126	0.998	cytokine receptor binding
GO:0019838	0.980	growth factor binding
GO:0004897	0.782	ciliary neurotrophic factor receptor activity
GO:0004923	0.570	leukemia inhibitory factor receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0009987	0.992	cellular process
GO:0048522	0.983	positive regulation of cellular process
GO:0023052	0.975	signaling
GO:0051716	0.974	cellular response to stimulus
GO:0042127	0.965	regulation of cell population proliferation
GO:0007154	0.956	cell communication
GO:0008284	0.952	positive regulation of cell population proliferation
GO:0007165	0.948	signal transduction
GO:0071345	0.928	cellular response to cytokine stimulus
GO:0007166	0.910	cell surface receptor signaling pathway
GO:0019221	0.775	cytokine-mediated signaling pathway
GO:0019222	0.566	regulation of metabolic process
GO:0060255	0.540	regulation of macromolecule metabolic process
GO:0032502	0.524	developmental process
GO:0048856	0.492	anatomical structure development
GO:0009893	0.484	positive regulation of metabolic process
GO:0080090	0.474	regulation of primary metabolic process
GO:0051171	0.474	regulation of nitrogen compound metabolic process
GO:0010604	0.471	positive regulation of macromolecule metabolic process
GO:0031323	0.462	regulation of cellular metabolic process
GO:0007167	0.454	enzyme-linked receptor protein signaling pathway
GO:0048519	0.439	negative regulation of biological process
GO:0032501	0.396	multicellular organismal process
GO:0048523	0.391	negative regulation of cellular process
GO:0048583	0.373	regulation of response to stimulus
GO:0051173	0.337	positive regulation of nitrogen compound metabolic process
GO:0031325	0.310	positive regulation of cellular metabolic process
GO:0051246	0.304	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005886	0.998	plasma membrane
GO:0032991	0.995	protein-containing complex
GO:0043227	0.993	membrane-bounded organelle
GO:0005615	0.985	extracellular space
GO:0031982	0.978	vesicle
GO:0043235	0.930	receptor complex
GO:1903561	0.638	extracellular vesicle
GO:0005622	0.637	intracellular anatomical structure
GO:0070062	0.623	extracellular exosome
GO:0043231	0.467	intracellular membrane-bounded organelle
GO:0005737	0.405	cytoplasm
GO:0098796	0.302	membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]