StarFunc result for job id P42704

User Input

>input (1394 residues)
MAALLRSARWLLRAGAAPRLPLSLRLLPGGPGRLHAASYLPAARAGPVAGGLLSPARLYA
IAAKEKDIQEESTFSSRKISNQFDWALMRLDLSVRRTGRIPKKLLQKVFNDTCRSGGLGG
SHALLLLRSCGSLLPELKLEERTEFAHRIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFS
PTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVTEAVFSALVT
GHARAGDMENAENILTVMRDAGIEPGPDTYLALLNAYAEKGDIDHVKQTLEKVEKSELHL
MDRDLLQIIFSFSKAGYPQYVSEILEKVTCERRYIPDAMNLILLLVTEKLEDVALQILLA
CPVSKEDGPSVFGSFFLQHCVTMNTPVEKLTDYCKKLKEVQMHSFPLQFTLHCALLANKT
DLAKALMKAVKEEGFPIRPHYFWPLLVGRRKEKNVQGIIEILKGMQELGVHPDQETYTDY
VIPCFDSVNSARAILQENGCLSDSDMFSQAGLRSEAANGNLDFVLSFLKSNTLPISLQSI
RSSLLLGFRRSMNINLWSEITELLYKDGRYCQEPRGPTEAVGYFLYNLIDSMSDSEVQAK
EEHLRQYFHQLEKMNVKIPENIYRGIRNLLESYHVPELIKDAHLLVESKNLDFQKTVQLT
SSELESTLETLKAENQPIRDVLKQLILVLCSEENMQKALELKAKYESDMVTGGYAALINL
CCRHDKVEDALNLKEEFDRLDSSAVLDTGKYVGLVRVLAKHGKLQDAINILKEMKEKDVL
IKDTTALSFFHMLNGAALRGEIETVKQLHEAIVTLGLAEPSTNISFPLVTVHLEKGDLST
ALEVAIDCYEKYKVLPRIHDVLCKLVEKGETDLIQKAMDFVSQEQGEMVMLYDLFFAFLQ
TGNYKEAKKIIETPGIRARSARLQWFCDRCVANNQVETLEKLVELTQKLFECDRDQMYYN
LLKLYKINGDWQRADAVWNKIQEENVIPREKTLRLLAEILREGNQEVPFDVPELWYEDEK
HSLNSSSASTTEPDFQKDILIACRLNQKKGAYDIFLNAKEQNIVFNAETYSNLIKLLMSE
DYFTQAMEVKAFAETHIKGFTLNDAANSRLIITQVRRDYLKEAVTTLKTVLDQQQTPSRL
AVTRVIQALAMKGDVENIEVVQKMLNGLEDSIGLSKMVFINNIALAQIKNNNIDAAIENI
ENMLTSENKVIEPQYFGLAYLFRKVIEEQLEPAVEKISIMAERLANQFAIYKPVTDFFLQ
LVDAGKVDDARALLQRCGAIAEQTPILLLFLLRNSRKQGKASTVKSVLELIPELNEKEEA
YNSLMKSYVSEKDVTSAKALYEHLTAKNTKLDDLFLKRYASLLKYAGEPVPFIEPPESFE
FYAQQLRKLRENSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42704	1.000	1.000	0.000	1394	1.000	1.000	P42704.pdb.gz	LPPRC_HUMAN Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3
2	AFDB:Q6PB66	0.612	0.613	0.000	1392	0.750	0.751	Q6PB66.pdb.gz	LPPRC_MOUSE Leucine-rich PPR motif-containing protein, mitochondrial OS=Mus musculus OX=10090 GN=Lrpprc PE=1 SV=2
3	AFDB:Q9VJ86	0.345	0.341	1.979E-58	1412	0.269	0.266	Q9VJ86.pdb.gz	Q9VJ86_DROME Bicoid stability factor OS=Drosophila melanogaster OX=7227 GN=bsf PE=1 SV=2
4	AFDB:Q5BIM0	0.275	0.340	5.606E-32	1072	0.148	0.193	Q5BIM0.pdb.gz	Q5BIM0_DROME UT01249p OS=Drosophila melanogaster OX=7227 GN=Lrpprc2 PE=2 SV=1
5	AFDB:Q9SZ52	0.174	0.210	4.493E-22	1112	0.124	0.156	Q9SZ52.pdb.gz	PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGR3 PE=1 SV=1
6	AFDB:Q5G1S8	0.165	0.163	1.033E-19	1440	0.139	0.135	Q5G1S8.pdb.gz	PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB1270 PE=2 SV=2
7	AFDB:O04647	0.120	0.147	6.804E-17	1038	0.101	0.136	O04647.pdb.gz	PP399_ARATH Pentatricopeptide repeat-containing protein At5g27270 OS=Arabidopsis thaliana OX=3702 GN=EMB976 PE=2 SV=2
8	AFDB:Q9FMQ1	0.126	0.194	9.597E-16	816	0.094	0.161	Q9FMQ1.pdb.gz	PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g12100 PE=2 SV=1
9	AFDB:Q9SUD8	0.137	0.238	2.554E-15	704	0.081	0.161	Q9SUD8.pdb.gz	PP340_ARATH Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana OX=3702 GN=At4g28010 PE=2 SV=1
10	AFDB:Q9LFF1	0.153	0.247	6.098E-15	754	0.095	0.175	Q9LFF1.pdb.gz	PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MEE40 PE=2 SV=1
11	PDB:4m57A	0.164	0.270	4.023E-12	702	0.089	0.177	4m57A.pdb.gz
12	PDB:7qdrB	0.112	0.123	1.379E-9	1212	0.111	0.128	7qdrB.pdb.gz
13	PDB:1xi4A	0.104	0.092	1.745E-8	1630	0.129	0.110	1xi4A.pdb.gz
14	PDB:4bujB	0.112	0.113	1.809E-8	1367	0.115	0.117	4bujB.pdb.gz
15	PDB:7dkhI	0.110	0.153	5.270E-7	914	0.095	0.144	7dkhI.pdb.gz
16	PDB:6tedQ	0.099	0.139	5.875E-7	890	0.093	0.145	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
17	PDB:7sqcR1	0.112	0.090	2.330E-6	2080	0.148	0.100	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:7po24	0.139	0.267	2.598E-6	592	0.051	0.120	7po24.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
19	PDB:6z2wE	0.114	0.080	4.475E-6	2325	0.141	0.085	6z2wE.pdb.gz	Mechanism of auto-inhibition and activation of Mec1 ATR checkpoint kinase.
20	PDB:7sx3D	0.104	0.103	6.201E-6	1418	0.123	0.121	7sx3D.pdb.gz	Structural architecture of the human NALCN channelosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DG06	0.0	1101	531	0.378	0.992	A0A0C4DG06_HUMAN Leucine rich pentatricopeptide repeat containing OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=1
2	B8ZZ38	0.0	1726	841	0.598	0.992	B8ZZ38_HUMAN Leucine rich pentatricopeptide repeat containing OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=2
3	C9JCA9	0.0	1728	837	0.599	0.998	C9JCA9_HUMAN Leucine rich pentatricopeptide repeat containing OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=2
4	E5KNY5	0.0	2873	1394	1.000	1.000	E5KNY5_HUMAN Leucine-rich PPR-motif containing OS=Homo sapiens OX=9606 GN=LRPPRC PE=4 SV=1
5	P42704	0.0	2873	1394	1.000	1.000	LPPRC_HUMAN Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3
6	Q6PB66	0.0	2138	1392	0.753	0.754	LPPRC_MOUSE Leucine-rich PPR motif-containing protein, mitochondrial OS=Mus musculus OX=10090 GN=Lrpprc PE=1 SV=2
7	Q9VJ86	2.69e-98	348	1412	0.131	0.129	Q9VJ86_DROME Bicoid stability factor OS=Drosophila melanogaster OX=7227 GN=bsf PE=1 SV=2
8	Q95NR4	3.91e-98	347	1412	0.130	0.128	Q95NR4_DROME Bicoid mRNA stability factor OS=Drosophila melanogaster OX=7227 GN=bsf PE=2 SV=1
9	Q5BIM0	4.75e-37	154	1072	0.163	0.212	Q5BIM0_DROME UT01249p OS=Drosophila melanogaster OX=7227 GN=Lrpprc2 PE=2 SV=1
10	Q9W592	5.69e-37	154	1072	0.164	0.214	Q9W592_DROME EG:BACN32G11.3 protein OS=Drosophila melanogaster OX=7227 GN=Lrpprc2 PE=1 SV=1
11	Q8S9D1	9.51e-14	79.0	831	0.038	0.064	PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana OX=3702 GN=ATC401 PE=2 SV=1
12	Q0WVK7	1.01e-12	75.5	741	0.035	0.066	PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g05670 PE=2 SV=1
13	O04491	1.28e-12	74.7	607	0.036	0.082	PPR26_ARATH Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana OX=3702 GN=At1g09680 PE=3 SV=1
14	Q9T0D6	3.82e-12	73.2	566	0.030	0.074	PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana OX=3702 GN=At4g11690 PE=2 SV=1
15	Q8L844	1.63e-11	71.2	709	0.037	0.072	PP413_ARATH Pentatricopeptide repeat-containing protein At5g42310, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CRP1 PE=1 SV=1
16	Q0WMY5	2.48e-11	70.9	952	0.031	0.045	PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPR4 PE=1 SV=1
17	Q9LN69	3.10e-11	70.9	904	0.034	0.052	PPR50_ARATH Putative pentatricopeptide repeat-containing protein At1g19290 OS=Arabidopsis thaliana OX=3702 GN=At1g19290 PE=3 SV=2
18	F4IJS7	3.65e-11	70.1	613	0.037	0.083	F4IJS7_ARATH Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=PPR_66 PE=1 SV=1
19	Q9SAK0	5.50e-11	69.7	836	0.034	0.057	PP132_ARATH Pentatricopeptide repeat-containing protein At1g79490, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB2217 PE=2 SV=1
20	A0A1D6IEG9	1.31e-10	68.6	668	0.057	0.120	CRP1_MAIZE Pentatricopeptide repeat-containing protein CRP1, chloroplastic OS=Zea mays OX=4577 GN=CRP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12491 ApoB100_C	4.8e+02	12.1	Apolipoprotein B100 C terminal
2	PF02847 MA3	1.2	20.5	MA3 domain
3	PF01535 PPR	1.7e-26	101.6	PPR repeat
4	PF12854 PPR_1	5.5e-14	62.9	PPR repeat
5	PF13041 PPR_2	2.6e-28	109.3	PPR repeat family
6	PF13812 PPR_3	2.5e-21	86.8	Pentatricopeptide repeat domain
7	PF17177 PPR_long	8.3e-19	79.3	Pentacotripeptide-repeat region of PRORP
8	PF13428 TPR_14	0.18	23.7	Tetratricopeptide repeat
9	PF14559 TPR_19	1.1e-05	37.1	Tetratricopeptide repeat
10	PF17874 TPR_MalT	1.3e+02	13.4	MalT-like TPR region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260665

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000450909	0.996	SRA stem-loop-interacting RNA-binding protein, mitochondrial
2	9606.ENSP00000264867	0.981	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
3	9606.ENSP00000325313	0.976	Microtubule-associated protein 1S
4	9606.ENSP00000355231	0.966	Beclin-1
5	9606.ENSP00000307786	0.923	Cytochrome c
6	9606.ENSP00000269571	0.909	Receptor tyrosine-protein kinase erbB-2
7	9606.ENSP00000340944	0.905	Tyrosine-protein phosphatase non-receptor type 11
8	9606.ENSP00000387784	0.903	Son of sevenless homolog 1
9	9606.ENSP00000264657	0.901	Signal transducer and activator of transcription 3
10	9606.ENSP00000343204	0.900	Tyrosine-protein kinase JAK1
11	9606.ENSP00000357470	0.900	Interleukin-6 receptor subunit alpha
12	9606.ENSP00000371067	0.900	Tyrosine-protein kinase JAK2
13	9606.ENSP00000376345	0.900	Growth factor receptor-bound protein 2
14	9606.ENSP00000385675	0.900	Interleukin-6
15	9606.ENSP00000391676	0.900	Tyrosine-protein kinase JAK3
16	9606.ENSP00000401303	0.900	SHC-transforming protein 1
17	9606.ENSP00000384863	0.897	Exportin-1
18	9606.ENSP00000425561	0.887	Eukaryotic translation initiation factor 4E
19	9606.ENSP00000465759	0.860	DNA-directed RNA polymerase, mitochondrial
20	9606.ENSP00000254630	0.859	Pentatricopeptide repeat domain-containing protein 3, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0008017	0.960	microtubule binding
GO:0048487	0.955	beta-tubulin binding
GO:0019899	0.793	enzyme binding
GO:0044389	0.722	ubiquitin-like protein ligase binding
GO:0031625	0.708	ubiquitin protein ligase binding
GO:0003729	0.636	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0044237	0.911	cellular metabolic process
GO:0071704	0.880	organic substance metabolic process
GO:0006810	0.875	transport
GO:0030705	0.861	cytoskeleton-dependent intracellular transport
GO:0099111	0.860	microtubule-based transport
GO:0007017	0.842	microtubule-based process
GO:0044238	0.827	primary metabolic process
GO:0006807	0.806	nitrogen compound metabolic process
GO:0065007	0.768	biological regulation
GO:0043170	0.710	macromolecule metabolic process
GO:0051640	0.690	organelle localization
GO:0010970	0.682	transport along microtubule
GO:0051646	0.675	mitochondrion localization
GO:0050789	0.666	regulation of biological process
GO:0072384	0.631	organelle transport along microtubule
GO:0034643	0.590	establishment of mitochondrion localization, microtubule-mediated
GO:0050794	0.564	regulation of cellular process
GO:0019222	0.474	regulation of metabolic process
GO:0034641	0.453	cellular nitrogen compound metabolic process
GO:0060255	0.439	regulation of macromolecule metabolic process
GO:0006139	0.435	nucleobase-containing compound metabolic process
GO:0051171	0.431	regulation of nitrogen compound metabolic process
GO:0080090	0.429	regulation of primary metabolic process
GO:0031323	0.426	regulation of cellular metabolic process
GO:0071840	0.399	cellular component organization or biogenesis
GO:0016043	0.337	cellular component organization
GO:0090304	0.317	nucleic acid metabolic process
GO:0010468	0.306	regulation of gene expression
GO:0047497	0.305	mitochondrion transport along microtubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0032991	0.910	protein-containing complex
GO:0043233	0.907	organelle lumen
GO:0070013	0.903	intracellular organelle lumen
GO:0005634	0.874	nucleus
GO:0016020	0.847	membrane
GO:0043232	0.396	intracellular non-membrane-bounded organelle
GO:0042645	0.377	mitochondrial nucleoid
GO:0000794	0.350	condensed nuclear chromosome
GO:0005874	0.349	microtubule
GO:0048471	0.341	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]