StarFunc result for job id P42765

User Input

>input (397 residues)
MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVL
QSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTE
SMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECD
KYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFK
KDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAI
SGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIALGHPLGGSGSR
ITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42765	1.000	1.000	9.382E-93	397	1.000	1.000	P42765.pdb.gz	THIM_HUMAN 3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2
2	PDB:4c2kD	0.993	0.988	7.495E-83	399	0.997	0.992	4c2kD.pdb.gz
3	AFDB:P13437	0.996	0.996	2.304E-81	397	0.874	0.874	P13437.pdb.gz	THIM_RAT 3-ketoacyl-CoA thiolase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acaa2 PE=1 SV=1
4	AFDB:B0S5C5	0.992	0.992	4.270E-77	397	0.768	0.768	B0S5C5.pdb.gz
5	AFDB:P76461	0.960	0.967	8.533E-53	394	0.426	0.429	P76461.pdb.gz	ATOB_ECOLI Acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=atoB PE=1 SV=1
6	AFDB:Q5XI22	0.947	0.947	2.016E-52	397	0.408	0.408	Q5XI22.pdb.gz	THIC_RAT Acetyl-CoA acetyltransferase, cytosolic OS=Rattus norvegicus OX=10116 GN=Acat2 PE=1 SV=1
7	AFDB:Q9BWD1	0.951	0.951	8.805E-52	397	0.411	0.411	Q9BWD1.pdb.gz	THIC_HUMAN Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2
8	AFDB:Q46939	0.961	0.971	1.273E-51	393	0.413	0.417	Q46939.pdb.gz	YQEF_ECOLI Probable acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=yqeF PE=3 SV=2
9	AFDB:P0C7L2	0.935	0.926	9.662E-51	401	0.436	0.431	P0C7L2.pdb.gz	PAAJ_ECOLI 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase OS=Escherichia coli (strain K12) OX=83333 GN=paaJ PE=1 SV=1
10	PDB:1wl4A	0.950	0.957	9.799E-51	394	0.423	0.426	1wl4A.pdb.gz	High Resolution Crystal Structures of Human Cytosolic Thiolase (CT): A Comparison of the Active Sites of Human CT, Bacterial Thiolase, and Bacterial KAS I
11	PDB:4wysA	0.959	0.961	1.293E-49	396	0.428	0.429	4wysA.pdb.gz
12	AFDB:Q86AD9	0.952	0.913	4.493E-48	414	0.388	0.372	Q86AD9.pdb.gz	THIL1_DICDI Probable acetyl-CoA acetyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271544 PE=2 SV=1
13	AFDB:O51136	0.940	0.938	6.495E-48	398	0.393	0.392	O51136.pdb.gz	O51136_BORBU Acetyl-CoA acetyltransferases subfamily OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0109 PE=3 SV=1
14	PDB:5xyjA	0.937	0.940	1.559E-45	396	0.375	0.376	5xyjA.pdb.gz
15	PDB:2ib8D	0.926	0.936	2.973E-44	393	0.406	0.410	2ib8D.pdb.gz	Crystallographic and Kinetic Studies of Human Mitochondrial Acetoacetyl-CoA Thiolase: The Importance of Potassium and Chloride Ions for Its Structure and Function
16	PDB:2iikB	0.871	0.865	4.570E-44	400	0.385	0.383	2iikB.pdb.gz
17	PDB:5f38A	0.899	0.961	8.446E-44	371	0.406	0.434	5f38A.pdb.gz	Crystal structure of a thiolase from Escherichia coli at 1.8 angstrom resolution.
18	PDB:2d3tC	0.887	0.903	3.262E-43	390	0.380	0.387	2d3tC.pdb.gz	Ligand-Induced Domain Rearrangement of Fatty Acid beta-Oxidation Multienzyme Complex
19	PDB:2wu9A	0.887	0.875	3.469E-43	403	0.385	0.380	2wu9A.pdb.gz
20	PDB:4b3iD	0.859	0.846	3.266E-41	403	0.363	0.357	4b3iD.pdb.gz	Structure of Mycobacterial Beta-Oxidation Trifunctional Enzyme Reveals its Altered Assembly and Putative Substrate Channeling Pathway.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J2A4	0.0	805	394	0.987	0.995	A0A0B4J2A4_HUMAN Acetyl-CoA acyltransferase 2 OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=1
2	P13437	0.0	737	397	0.874	0.874	THIM_RAT 3-ketoacyl-CoA thiolase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acaa2 PE=1 SV=1
3	P42765	0.0	815	397	1.000	1.000	THIM_HUMAN 3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2
4	Q7ZVG1	0.0	630	397	0.768	0.768	Q7ZVG1_DANRE 3-ketoacyl-CoA thiolase, mitochondrial OS=Danio rerio OX=7955 GN=zgc:56036 PE=1 SV=1
5	Q8BWT1	0.0	741	397	0.879	0.879	THIM_MOUSE 3-ketoacyl-CoA thiolase, mitochondrial OS=Mus musculus OX=10090 GN=Acaa2 PE=1 SV=3
6	P0C7L2	3.03e-101	308	401	0.441	0.436	PAAJ_ECOLI 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase OS=Escherichia coli (strain K12) OX=83333 GN=paaJ PE=1 SV=1
7	Q46939	3.79e-99	302	393	0.426	0.430	YQEF_ECOLI Probable acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=yqeF PE=3 SV=2
8	P76461	3.83e-99	302	394	0.433	0.437	ATOB_ECOLI Acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=atoB PE=1 SV=1
9	Q80X81	2.92e-98	300	397	0.408	0.408	Q80X81_MOUSE Acetyl-Coenzyme A acetyltransferase 3 OS=Mus musculus OX=10090 GN=Acat3 PE=1 SV=1
10	Q9BWD1	1.18e-97	298	397	0.423	0.423	THIC_HUMAN Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2
11	Q8R4V3	1.35e-96	295	397	0.403	0.403	Q8R4V3_MOUSE Acetyl CoA transferase-like protein OS=Mus musculus OX=10090 GN=Acat3 PE=2 SV=1
12	Q8CAY6	2.98e-94	290	397	0.411	0.411	THIC_MOUSE Acetyl-CoA acetyltransferase, cytosolic OS=Mus musculus OX=10090 GN=Acat2 PE=1 SV=2
13	Q5XI22	1.83e-93	288	397	0.408	0.408	THIC_RAT Acetyl-CoA acetyltransferase, cytosolic OS=Rattus norvegicus OX=10116 GN=Acat2 PE=1 SV=1
14	Q86AD9	2.22e-87	273	414	0.385	0.370	THIL1_DICDI Probable acetyl-CoA acetyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271544 PE=2 SV=1
15	O51136	1.24e-86	270	398	0.395	0.394	O51136_BORBU Acetyl-CoA acetyltransferases subfamily OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0109 PE=3 SV=1
16	Q9UQW6	2.12e-85	267	395	0.388	0.390	ERG10_SCHPO Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erg10 PE=2 SV=1
17	A0A140VJX1	1.12e-82	261	427	0.398	0.370	A0A140VJX1_HUMAN Testicular tissue protein Li 198 OS=Homo sapiens OX=9606 PE=2 SV=1
18	P24752	1.12e-82	261	427	0.398	0.370	THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
19	A0A5F9ZHL1	4.73e-80	254	434	0.398	0.364	A0A5F9ZHL1_HUMAN Acetyl-CoA acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
20	Q8LF48	9.94e-80	254	443	0.383	0.343	THIK1_ARATH 3-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=KAT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06135 IreB	4.1e+02	12.6	IreB regulatory phosphoprotein
2	PF00109 ketoacyl-synt	12	17.0	Beta-ketoacyl synthase, N-terminal domain
3	PF02803 Thiolase_C	1.1e-47	172.1	Thiolase, C-terminal domain
4	PF00108 Thiolase_N	1.5e-93	324.5	Thiolase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285093

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370023	0.995	Trifunctional enzyme subunit alpha, mitochondrial
2	9606.ENSP00000474560	0.990	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
3	9606.ENSP00000242592	0.987	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
4	9606.ENSP00000438689	0.983	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
5	9606.ENSP00000231887	0.982	Peroxisomal bifunctional enzyme
6	9606.ENSP00000357873	0.982	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
7	9606.ENSP00000359871	0.981	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
8	9606.ENSP00000233710	0.978	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
9	9606.ENSP00000168216	0.977	3-hydroxyacyl-CoA dehydrogenase type-2
10	9606.ENSP00000265838	0.973	Acetyl-CoA acetyltransferase, mitochondrial
11	9606.ENSP00000357535	0.972	Enoyl-CoA hydratase, mitochondrial
12	9606.ENSP00000293217	0.968	Peroxisomal acyl-coenzyme A oxidase 1
13	9606.ENSP00000358414	0.968	Hydroxymethylglutaryl-CoA synthase, mitochondrial
14	9606.ENSP00000322706	0.961	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
15	9606.ENSP00000381654	0.957	3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic
16	9606.ENSP00000348775	0.955	Peroxisomal acyl-coenzyme A oxidase 3
17	9606.ENSP00000363614	0.951	Hydroxymethylglutaryl-CoA lyase, mitochondrial
18	9606.ENSP00000365462	0.937	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
19	9606.ENSP00000263702	0.935	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
20	9606.ENSP00000436585	0.935	Ethylmalonyl-CoA decarboxylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003988	1.000	acetyl-CoA C-acyltransferase activity
GO:0005515	0.998	protein binding
GO:0016787	0.995	hydrolase activity
GO:0047617	0.994	acyl-CoA hydrolase activity
GO:0016453	0.987	C-acetyltransferase activity
GO:1901363	0.970	heterocyclic compound binding
GO:0097159	0.969	organic cyclic compound binding
GO:0003985	0.796	acetyl-CoA C-acetyltransferase activity
GO:0016491	0.329	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0071704	0.967	organic substance metabolic process
GO:0044238	0.921	primary metabolic process
GO:0044237	0.907	cellular metabolic process
GO:0044281	0.840	small molecule metabolic process
GO:0065007	0.789	biological regulation
GO:0006629	0.728	lipid metabolic process
GO:0050794	0.725	regulation of cellular process
GO:0019752	0.547	carboxylic acid metabolic process
GO:0006631	0.405	fatty acid metabolic process
GO:0009056	0.402	catabolic process
GO:0044248	0.363	cellular catabolic process
GO:0006807	0.356	nitrogen compound metabolic process
GO:1901575	0.325	organic substance catabolic process
GO:1901564	0.317	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0005759	0.946	mitochondrial matrix
GO:0016020	0.695	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21564	1.000	acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA
EC:2.3.1.16	1.000	acetyl-CoA C-acyltransferase.
EC:3.-.-.-	0.995	Hydrolases.
RHEA:16781	0.994	a fatty acyl-CoA + H2O = a fatty acid + CoA + H(+)
EC:3.1.2.20	0.994	acyl-CoA hydrolase.
RHEA:21036	0.796	2 acetyl-CoA = acetoacetyl-CoA + CoA
EC:2.3.1.9	0.796	acetyl-CoA C-acetyltransferase.
EC:1.-.-.-	0.329	Oxidoreductases.

[back to server]