StarFunc result for job id P42771

User Input

>input (156 residues)
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA
ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE
LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42771	1.000	1.000	2.088E-25	156	1.000	1.000	P42771.pdb.gz	CDN2A_HUMAN Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A PE=1 SV=2
2	PDB:1a5eA	0.770	0.770	1.818E-19	156	1.000	1.000	1a5eA.pdb.gz
3	AFDB:P42772	0.825	0.930	4.275E-18	138	0.699	0.790	P42772.pdb.gz	CDN2B_HUMAN Cyclin-dependent kinase 4 inhibitor B OS=Homo sapiens OX=9606 GN=CDKN2B PE=1 SV=1
4	AFDB:P55271	0.792	0.949	1.204E-17	130	0.692	0.831	P55271.pdb.gz	CDN2B_MOUSE Cyclin-dependent kinase 4 inhibitor B OS=Mus musculus OX=10090 GN=Cdkn2b PE=1 SV=1
5	AFDB:P51480	0.827	0.769	2.759E-17	168	0.628	0.583	P51480.pdb.gz	CDN2A_MOUSE Cyclin-dependent kinase inhibitor 2A OS=Mus musculus OX=10090 GN=Cdkn2a PE=1 SV=2
6	AFDB:Q9R0Z3	0.798	0.783	3.223E-17	159	0.635	0.623	Q9R0Z3.pdb.gz	CDN2A_RAT Cyclin-dependent kinase inhibitor 2A OS=Rattus norvegicus OX=10116 GN=Cdkn2a PE=2 SV=1
7	PDB:1d9sA	0.749	0.851	5.475E-13	136	0.705	0.809	1d9sA.pdb.gz
8	PDB:1bd8A	0.744	0.744	8.326E-11	156	0.391	0.391	1bd8A.pdb.gz
9	AFDB:A0A024R796	0.760	0.715	3.543E-10	166	0.391	0.367	A0A024R796.pdb.gz
10	AFDB:Q60773	0.749	0.705	4.138E-10	166	0.385	0.361	Q60773.pdb.gz	CDN2D_MOUSE Cyclin-dependent kinase 4 inhibitor D OS=Mus musculus OX=10090 GN=Cdkn2d PE=1 SV=2
11	AFDB:P42773	0.680	0.634	2.062E-9	168	0.359	0.333	P42773.pdb.gz	CDN2C_HUMAN Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens OX=9606 GN=CDKN2C PE=1 SV=1
12	AFDB:Q09103	0.718	0.085	7.743E-8	1457	0.237	0.025	Q09103.pdb.gz	DGK2_DROME Eye-specific diacylglycerol kinase OS=Drosophila melanogaster OX=7227 GN=rdgA PE=2 SV=2
13	AFDB:M0QX15	0.745	0.209	1.234E-7	589	0.282	0.075	M0QX15.pdb.gz	M0QX15_HUMAN Ankyrin repeat and LEM domain containing 1 OS=Homo sapiens OX=9606 GN=ANKLE1 PE=1 SV=4
14	PDB:1ap7A	0.719	0.671	1.445E-7	168	0.397	0.369	1ap7A.pdb.gz
15	PDB:1bu9A	0.634	0.593	3.671E-7	168	0.333	0.310	1bu9A.pdb.gz
16	PDB:8cs9A	0.695	0.142	6.339E-6	796	0.212	0.041	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
17	PDB:2dvwA	0.682	0.471	1.981E-5	229	0.250	0.170	2dvwA.pdb.gz
18	PDB:4oauC	0.673	0.164	3.689E-5	692	0.212	0.048	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
19	PDB:6v9hC	0.683	0.402	4.309E-5	270	0.218	0.126	6v9hC.pdb.gz
20	PDB:3ehqA	0.637	0.552	6.521E-5	182	0.179	0.154	3ehqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P42771	5.85e-108	306	156	1.000	1.000	CDN2A_HUMAN Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A PE=1 SV=2
2	P55271	2.11e-70	210	130	0.686	0.823	CDN2B_MOUSE Cyclin-dependent kinase 4 inhibitor B OS=Mus musculus OX=10090 GN=Cdkn2b PE=1 SV=1
3	P55272	1.15e-69	208	130	0.673	0.808	CDN2B_RAT Cyclin-dependent kinase 4 inhibitor B OS=Rattus norvegicus OX=10116 GN=Cdkn2b PE=2 SV=1
4	P42772	5.35e-69	206	138	0.705	0.797	CDN2B_HUMAN Cyclin-dependent kinase 4 inhibitor B OS=Homo sapiens OX=9606 GN=CDKN2B PE=1 SV=1
5	P51480	4.02e-58	180	168	0.596	0.554	CDN2A_MOUSE Cyclin-dependent kinase inhibitor 2A OS=Mus musculus OX=10090 GN=Cdkn2a PE=1 SV=2
6	Q9R0Z3	1.07e-57	179	159	0.615	0.604	CDN2A_RAT Cyclin-dependent kinase inhibitor 2A OS=Rattus norvegicus OX=10116 GN=Cdkn2a PE=2 SV=1
7	P55273	1.67e-26	99.8	166	0.391	0.367	CDN2D_HUMAN Cyclin-dependent kinase 4 inhibitor D OS=Homo sapiens OX=9606 GN=CDKN2D PE=1 SV=1
8	Q60773	4.05e-26	99.0	166	0.391	0.367	CDN2D_MOUSE Cyclin-dependent kinase 4 inhibitor D OS=Mus musculus OX=10090 GN=Cdkn2d PE=1 SV=2
9	Q60772	8.26e-21	85.5	168	0.359	0.333	CDN2C_MOUSE Cyclin-dependent kinase 4 inhibitor C OS=Mus musculus OX=10090 GN=Cdkn2c PE=1 SV=1
10	Q8R5G4	1.34e-20	84.7	168	0.353	0.327	Q8R5G4_RAT Cyclin-dependent kinase inhibitor 2C OS=Rattus norvegicus OX=10116 GN=Cdkn2c PE=1 SV=1
11	P42773	1.49e-20	84.7	168	0.353	0.327	CDN2C_HUMAN Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens OX=9606 GN=CDKN2C PE=1 SV=1
12	A0A5F9ZHF7	1.23e-11	63.9	3862	0.314	0.013	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZHT4	1.23e-11	63.9	3870	0.314	0.013	A0A5F9ZHT4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	A0A5F9ZHN5	1.25e-11	63.5	3903	0.314	0.013	A0A5F9ZHN5_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A5F9ZI46	1.25e-11	63.5	3882	0.314	0.013	A0A5F9ZI46_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZGY3	1.26e-11	63.5	3934	0.314	0.012	A0A5F9ZGY3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZH19	1.26e-11	63.5	3895	0.314	0.013	A0A5F9ZH19_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZH30	1.26e-11	63.5	3995	0.314	0.012	A0A5F9ZH30_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZHD2	1.26e-11	63.5	3936	0.314	0.012	A0A5F9ZHD2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZHE4	1.26e-11	63.5	3964	0.314	0.012	A0A5F9ZHE4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.21	23.3	Ankyrin repeat
2	PF12796 Ank_2	0.004	29.0	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	87	15.1	Ankyrin repeat
4	PF13637 Ank_4	8.4e-06	37.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3.2e-06	38.6	Ankyrin repeats (many copies)
6	PF09722 Xre_MbcA_ParS_C	4.7e+02	12.3	Antitoxin Xre/MbcA/ParS C-terminal toxin-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000035617

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000033192	0.999	Cyclin-dependent kinase 6
2	9598.ENSPTRP00000039845	0.998	Cyclin-dependent kinase 4
3	9598.ENSPTRP00000050081	0.998	Belongs to the MDM2/MDM4 family.
4	9598.ENSPTRP00000014836	0.996	Cellular tumor antigen p53
5	9598.ENSPTRP00000035190	0.995	Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release (By similarity).
6	9598.ENSPTRP00000006874	0.992	Belongs to the cyclin family.
7	9598.ENSPTRP00000007779	0.977	Cyclin D2
8	9598.ENSPTRP00000050150	0.966	Cyclin D3
9	9598.ENSPTRP00000058757	0.950	Uncharacterized protein
10	9598.ENSPTRP00000005495	0.949	HRas proto-oncogene, GTPase
11	9598.ENSPTRP00000008150	0.947	Uncharacterized protein
12	9598.ENSPTRP00000001956	0.913	Neuroblastoma RAS viral (V-ras) oncogene homolog
13	9598.ENSPTRP00000012969	0.906	Ubiquitin-conjugating enzyme E2I
14	9598.ENSPTRP00000010887	0.896	Uncharacterized protein
15	9598.ENSPTRP00000022981	0.881	E2F transcription factor 1
16	9598.ENSPTRP00000017047	0.870	Mothers against decapentaplegic homolog
17	9598.ENSPTRP00000026912	0.868	Phosphoinositide-3-kinase, catalytic, alpha polypeptide
18	9598.ENSPTRP00000009974	0.865	RB transcriptional corepressor 1
19	9598.ENSPTRP00000047397	0.860	HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase
20	9598.ENSPTRP00000030915	0.856	Mitogen-activated protein kinase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.999	protein kinase binding
GO:1901363	0.997	heterocyclic compound binding
GO:0004861	0.997	cyclin-dependent protein serine/threonine kinase inhibitor activity
GO:0097159	0.996	organic cyclic compound binding
GO:0003676	0.942	nucleic acid binding
GO:0051059	0.885	NF-kappaB binding
GO:0003723	0.838	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0048523	0.993	negative regulation of cellular process
GO:0009987	0.988	cellular process
GO:0044237	0.982	cellular metabolic process
GO:0051726	0.980	regulation of cell cycle
GO:0019222	0.979	regulation of metabolic process
GO:0065009	0.971	regulation of molecular function
GO:0031323	0.971	regulation of cellular metabolic process
GO:0080090	0.969	regulation of primary metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0010605	0.966	negative regulation of macromolecule metabolic process
GO:0051716	0.961	cellular response to stimulus
GO:0045859	0.954	regulation of protein kinase activity
GO:0006950	0.949	response to stress
GO:0051172	0.948	negative regulation of nitrogen compound metabolic process
GO:0007165	0.944	signal transduction
GO:0006355	0.940	regulation of DNA-templated transcription
GO:0031324	0.926	negative regulation of cellular metabolic process
GO:1904029	0.925	regulation of cyclin-dependent protein kinase activity
GO:0007346	0.904	regulation of mitotic cell cycle
GO:0033554	0.897	cellular response to stress
GO:0048518	0.887	positive regulation of biological process
GO:0042127	0.880	regulation of cell population proliferation
GO:0048522	0.876	positive regulation of cellular process
GO:0071900	0.867	regulation of protein serine/threonine kinase activity
GO:1901987	0.864	regulation of cell cycle phase transition
GO:1902806	0.852	regulation of cell cycle G1/S phase transition
GO:0071704	0.849	organic substance metabolic process
GO:1901990	0.832	regulation of mitotic cell cycle phase transition
GO:0035556	0.832	intracellular signal transduction
GO:0008285	0.828	negative regulation of cell population proliferation
GO:2000045	0.824	regulation of G1/S transition of mitotic cell cycle
GO:0044238	0.822	primary metabolic process
GO:0032502	0.802	developmental process
GO:0051090	0.792	regulation of DNA-binding transcription factor activity
GO:0010563	0.781	negative regulation of phosphorus metabolic process
GO:0006807	0.764	nitrogen compound metabolic process
GO:0044092	0.752	negative regulation of molecular function
GO:0032501	0.751	multicellular organismal process
GO:0031400	0.744	negative regulation of protein modification process
GO:0051253	0.732	negative regulation of RNA metabolic process
GO:0045936	0.729	negative regulation of phosphate metabolic process
GO:0045786	0.725	negative regulation of cell cycle
GO:0040008	0.717	regulation of growth
GO:0048856	0.704	anatomical structure development
GO:0051128	0.697	regulation of cellular component organization
GO:0000079	0.692	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0030155	0.678	regulation of cell adhesion
GO:0042326	0.674	negative regulation of phosphorylation
GO:0043170	0.653	macromolecule metabolic process
GO:0010558	0.622	negative regulation of macromolecule biosynthetic process
GO:0031327	0.622	negative regulation of cellular biosynthetic process
GO:1903507	0.587	negative regulation of nucleic acid-templated transcription
GO:0043433	0.584	negative regulation of DNA-binding transcription factor activity
GO:0001933	0.581	negative regulation of protein phosphorylation
GO:0045926	0.579	negative regulation of growth
GO:0045892	0.579	negative regulation of DNA-templated transcription
GO:0007275	0.578	multicellular organism development
GO:0043086	0.559	negative regulation of catalytic activity
GO:0030308	0.514	negative regulation of cell growth
GO:0006469	0.509	negative regulation of protein kinase activity
GO:0048583	0.503	regulation of response to stimulus
GO:0009893	0.497	positive regulation of metabolic process
GO:0048731	0.493	system development
GO:0031325	0.483	positive regulation of cellular metabolic process
GO:0090398	0.470	cellular senescence
GO:0042221	0.467	response to chemical
GO:0051173	0.457	positive regulation of nitrogen compound metabolic process
GO:0071901	0.452	negative regulation of protein serine/threonine kinase activity
GO:0010810	0.448	regulation of cell-substrate adhesion
GO:0023051	0.419	regulation of signaling
GO:0010646	0.419	regulation of cell communication
GO:0016043	0.396	cellular component organization
GO:0032088	0.388	negative regulation of NF-kappaB transcription factor activity
GO:0048869	0.366	cellular developmental process
GO:0030154	0.360	cell differentiation
GO:0010604	0.340	positive regulation of macromolecule metabolic process
GO:0009966	0.336	regulation of signal transduction
GO:0010941	0.328	regulation of cell death
GO:0051239	0.318	regulation of multicellular organismal process
GO:0050793	0.314	regulation of developmental process
GO:0006357	0.311	regulation of transcription by RNA polymerase II
GO:0070887	0.309	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0031981	0.960	nuclear lumen
GO:0000785	0.959	chromatin
GO:0005654	0.748	nucleoplasm
GO:0000792	0.659	heterochromatin
GO:0032991	0.400	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]