StarFunc result for job id P42772

User Input

>input (138 residues)
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR
VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA
EERGHRDVAGYLRTATGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42772	1.000	1.000	6.681E-23	138	1.000	1.000	P42772.pdb.gz	CDN2B_HUMAN Cyclin-dependent kinase 4 inhibitor B OS=Homo sapiens OX=9606 GN=CDKN2B PE=1 SV=1
2	AFDB:P55271	0.920	0.976	3.909E-18	130	0.819	0.869	P55271.pdb.gz	CDN2B_MOUSE Cyclin-dependent kinase 4 inhibitor B OS=Mus musculus OX=10090 GN=Cdkn2b PE=1 SV=1
3	AFDB:P42771	0.929	0.824	2.929E-17	156	0.790	0.699	P42771.pdb.gz	CDN2A_HUMAN Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A PE=1 SV=2
4	AFDB:Q9R0Z3	0.886	0.771	3.501E-15	159	0.630	0.547	Q9R0Z3.pdb.gz	CDN2A_RAT Cyclin-dependent kinase inhibitor 2A OS=Rattus norvegicus OX=10116 GN=Cdkn2a PE=2 SV=1
5	AFDB:P51480	0.887	0.731	1.586E-14	168	0.609	0.500	P51480.pdb.gz	CDN2A_MOUSE Cyclin-dependent kinase inhibitor 2A OS=Mus musculus OX=10090 GN=Cdkn2a PE=1 SV=2
6	PDB:1a5eA	0.819	0.730	8.203E-14	156	0.775	0.686	1a5eA.pdb.gz
7	PDB:1d9sA	0.837	0.848	2.362E-13	136	0.826	0.838	1d9sA.pdb.gz
8	AFDB:A0A024R796	0.841	0.701	4.755E-11	166	0.435	0.361	A0A024R796.pdb.gz
9	PDB:1bd8A	0.847	0.751	6.317E-11	156	0.435	0.385	1bd8A.pdb.gz
10	AFDB:Q60773	0.844	0.703	6.432E-11	166	0.442	0.367	Q60773.pdb.gz	CDN2D_MOUSE Cyclin-dependent kinase 4 inhibitor D OS=Mus musculus OX=10090 GN=Cdkn2d PE=1 SV=2
11	AFDB:P42773	0.852	0.703	2.808E-9	168	0.377	0.310	P42773.pdb.gz	CDN2C_HUMAN Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens OX=9606 GN=CDKN2C PE=1 SV=1
12	AFDB:Q09103	0.796	0.084	1.166E-7	1457	0.254	0.024	Q09103.pdb.gz	DGK2_DROME Eye-specific diacylglycerol kinase OS=Drosophila melanogaster OX=7227 GN=rdgA PE=2 SV=2
13	AFDB:Q6NXT1	0.756	0.359	1.289E-7	300	0.326	0.150	Q6NXT1.pdb.gz	ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens OX=9606 GN=ANKRD54 PE=1 SV=2
14	PDB:1ap7A	0.792	0.658	1.332E-7	168	0.442	0.363	1ap7A.pdb.gz
15	PDB:1bu9A	0.820	0.682	3.296E-7	168	0.406	0.333	1bu9A.pdb.gz
16	PDB:8cs9A	0.788	0.143	1.760E-5	796	0.254	0.044	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
17	PDB:3ehqA	0.707	0.549	3.063E-5	182	0.225	0.170	3ehqA.pdb.gz
18	PDB:4oauC	0.727	0.160	5.893E-5	692	0.232	0.046	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
19	PDB:2dvwA	0.793	0.489	9.272E-5	229	0.268	0.162	2dvwA.pdb.gz
20	PDB:6v9hC	0.772	0.408	9.272E-5	270	0.268	0.137	6v9hC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P42772	9.27e-96	273	138	1.000	1.000	CDN2B_HUMAN Cyclin-dependent kinase 4 inhibitor B OS=Homo sapiens OX=9606 GN=CDKN2B PE=1 SV=1
2	P55272	5.05e-77	226	130	0.819	0.869	CDN2B_RAT Cyclin-dependent kinase 4 inhibitor B OS=Rattus norvegicus OX=10116 GN=Cdkn2b PE=2 SV=1
3	P55271	1.30e-76	225	130	0.819	0.869	CDN2B_MOUSE Cyclin-dependent kinase 4 inhibitor B OS=Mus musculus OX=10090 GN=Cdkn2b PE=1 SV=1
4	P42771	4.73e-69	206	156	0.797	0.705	CDN2A_HUMAN Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A PE=1 SV=2
5	P51480	1.47e-52	165	168	0.572	0.470	CDN2A_MOUSE Cyclin-dependent kinase inhibitor 2A OS=Mus musculus OX=10090 GN=Cdkn2a PE=1 SV=2
6	Q9R0Z3	5.18e-52	164	159	0.580	0.503	CDN2A_RAT Cyclin-dependent kinase inhibitor 2A OS=Rattus norvegicus OX=10116 GN=Cdkn2a PE=2 SV=1
7	Q60773	5.00e-28	103	166	0.442	0.367	CDN2D_MOUSE Cyclin-dependent kinase 4 inhibitor D OS=Mus musculus OX=10090 GN=Cdkn2d PE=1 SV=2
8	P55273	5.39e-28	103	166	0.435	0.361	CDN2D_HUMAN Cyclin-dependent kinase 4 inhibitor D OS=Homo sapiens OX=9606 GN=CDKN2D PE=1 SV=1
9	Q60772	2.51e-20	83.6	168	0.391	0.321	CDN2C_MOUSE Cyclin-dependent kinase 4 inhibitor C OS=Mus musculus OX=10090 GN=Cdkn2c PE=1 SV=1
10	Q8R5G4	3.47e-20	83.2	168	0.384	0.315	Q8R5G4_RAT Cyclin-dependent kinase inhibitor 2C OS=Rattus norvegicus OX=10116 GN=Cdkn2c PE=1 SV=1
11	P42773	9.50e-20	82.0	168	0.384	0.315	CDN2C_HUMAN Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens OX=9606 GN=CDKN2C PE=1 SV=1
12	Q91WK7	5.00e-12	63.5	299	0.297	0.137	ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus OX=10090 GN=Ankrd54 PE=1 SV=1
13	Q6NXT1	1.27e-11	62.4	300	0.297	0.137	ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens OX=9606 GN=ANKRD54 PE=1 SV=2
14	Q8WXK1	1.88e-10	59.3	588	0.304	0.071	ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens OX=9606 GN=ASB15 PE=1 SV=3
15	O15084	2.82e-10	58.9	1053	0.297	0.039	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
16	Q8GZ22	3.08e-09	55.5	240	0.312	0.179	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
17	Q8N8A2	1.01e-08	54.7	993	0.319	0.044	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
18	Q80YE7	1.36e-08	54.3	1442	0.290	0.028	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
19	Q3UES3	1.40e-08	54.3	1166	0.290	0.034	TNKS2_MOUSE Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2
20	Q9H2K2	1.98e-08	53.9	1166	0.290	0.034	TNKS2_HUMAN Poly [ADP-ribose] polymerase tankyrase-2 OS=Homo sapiens OX=9606 GN=TNKS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.58	21.9	Ankyrin repeat
2	PF12796 Ank_2	0.0002	33.2	Ankyrin repeats (3 copies)
3	PF13637 Ank_4	9.2e-05	34.2	Ankyrin repeats (many copies)
4	PF13857 Ank_5	0.0013	30.3	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276925

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257904	0.999	Cyclin-dependent kinase 4
2	9606.ENSP00000265734	0.998	Cyclin-dependent kinase 6
3	9606.ENSP00000227507	0.972	G1/S-specific cyclin-D1
4	9606.ENSP00000341551	0.963	Mothers against decapentaplegic homolog 4
5	9606.ENSP00000261254	0.959	G1/S-specific cyclin-D2
6	9606.ENSP00000262160	0.950	Mothers against decapentaplegic homolog 2
7	9606.ENSP00000332973	0.950	Mothers against decapentaplegic homolog 3
8	9606.ENSP00000362082	0.944	G1/S-specific cyclin-D3
9	9606.ENSP00000329357	0.942	Transcription factor Sp1
10	9606.ENSP00000384849	0.938	Cyclin-dependent kinase inhibitor 1
11	9606.ENSP00000479618	0.935	Myc proto-oncogene protein
12	9606.ENSP00000228872	0.930	Cyclin-dependent kinase inhibitor 1B
13	9606.ENSP00000305422	0.928	CCAAT/enhancer-binding protein beta
14	9606.ENSP00000413720	0.894	Cyclin-dependent kinase inhibitor 1C
15	9606.ENSP00000418915	0.864	Cyclin-dependent kinase inhibitor 2A
16	9606.ENSP00000480514	0.819	Calcium load-activated calcium channel
17	9606.ENSP00000369519	0.767	S-methyl-5'-thioadenosine phosphorylase
18	9606.ENSP00000269305	0.757	Cellular tumor antigen p53
19	9606.ENSP00000266970	0.722	Cyclin-dependent kinase 2
20	9606.ENSP00000258149	0.699	E3 ubiquitin-protein ligase Mdm2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004861	0.999	cyclin-dependent protein serine/threonine kinase inhibitor activity
GO:0019901	0.999	protein kinase binding
GO:0003824	0.391	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050896	0.987	response to stimulus
GO:0009987	0.986	cellular process
GO:0051726	0.986	regulation of cell cycle
GO:0048523	0.986	negative regulation of cellular process
GO:0060255	0.942	regulation of macromolecule metabolic process
GO:0042127	0.940	regulation of cell population proliferation
GO:0051716	0.918	cellular response to stimulus
GO:0032502	0.908	developmental process
GO:0048518	0.887	positive regulation of biological process
GO:0071900	0.866	regulation of protein serine/threonine kinase activity
GO:0048522	0.865	positive regulation of cellular process
GO:0008152	0.817	metabolic process
GO:0048856	0.795	anatomical structure development
GO:0009892	0.713	negative regulation of metabolic process
GO:0010646	0.662	regulation of cell communication
GO:0023051	0.652	regulation of signaling
GO:0048583	0.649	regulation of response to stimulus
GO:1904029	0.647	regulation of cyclin-dependent protein kinase activity
GO:0006950	0.640	response to stress
GO:0010468	0.618	regulation of gene expression
GO:0044237	0.608	cellular metabolic process
GO:0009966	0.541	regulation of signal transduction
GO:0031324	0.519	negative regulation of cellular metabolic process
GO:0007154	0.515	cell communication
GO:0033554	0.515	cellular response to stress
GO:0032501	0.500	multicellular organismal process
GO:0010605	0.485	negative regulation of macromolecule metabolic process
GO:0010564	0.438	regulation of cell cycle process
GO:0010556	0.413	regulation of macromolecule biosynthetic process
GO:0051172	0.410	negative regulation of nitrogen compound metabolic process
GO:0019219	0.406	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.385	organic substance metabolic process
GO:0031326	0.385	regulation of cellular biosynthetic process
GO:0009893	0.381	positive regulation of metabolic process
GO:0006807	0.374	nitrogen compound metabolic process
GO:0010604	0.339	positive regulation of macromolecule metabolic process
GO:0051252	0.339	regulation of RNA metabolic process
GO:0051173	0.336	positive regulation of nitrogen compound metabolic process
GO:0042221	0.330	response to chemical
GO:0007165	0.330	signal transduction
GO:0006355	0.319	regulation of DNA-templated transcription
GO:0048584	0.318	positive regulation of response to stimulus
GO:0044238	0.316	primary metabolic process
GO:0031325	0.306	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.981	cytosol
GO:0043233	0.345	organelle lumen
GO:0031981	0.335	nuclear lumen
GO:0032991	0.321	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]