StarFunc result for job id P42773

User Input

>input (168 residues)
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE
FLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42773	1.000	1.000	2.916E-26	168	1.000	1.000	P42773.pdb.gz	CDN2C_HUMAN Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens OX=9606 GN=CDKN2C PE=1 SV=1
2	PDB:1bu9A	0.884	0.884	6.322E-20	168	1.000	1.000	1bu9A.pdb.gz
3	AFDB:A0A024R796	0.882	0.892	1.277E-13	166	0.423	0.428	A0A024R796.pdb.gz
4	AFDB:Q60773	0.879	0.889	2.533E-13	166	0.429	0.434	Q60773.pdb.gz	CDN2D_MOUSE Cyclin-dependent kinase 4 inhibitor D OS=Mus musculus OX=10090 GN=Cdkn2d PE=1 SV=2
5	PDB:1bd8A	0.869	0.933	5.883E-13	156	0.423	0.455	1bd8A.pdb.gz
6	PDB:1ap7A	0.802	0.802	3.084E-10	168	0.429	0.429	1ap7A.pdb.gz
7	AFDB:P42772	0.731	0.885	1.864E-9	138	0.321	0.391	P42772.pdb.gz	CDN2B_HUMAN Cyclin-dependent kinase 4 inhibitor B OS=Homo sapiens OX=9606 GN=CDKN2B PE=1 SV=1
8	AFDB:P42771	0.634	0.678	2.500E-9	156	0.333	0.359	P42771.pdb.gz	CDN2A_HUMAN Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A PE=1 SV=2
9	AFDB:Q9SQK3	0.781	0.434	3.193E-9	315	0.280	0.149	Q9SQK3.pdb.gz	EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB506 PE=1 SV=1
10	AFDB:Q9CZK6	0.871	0.235	3.521E-9	655	0.321	0.082	Q9CZK6.pdb.gz	ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus OX=10090 GN=Anks3 PE=1 SV=2
11	AFDB:D3ZUV2	0.859	0.152	4.722E-9	1006	0.268	0.045	D3ZUV2.pdb.gz	D3ZUV2_RAT RING-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Mib1 PE=4 SV=3
12	AFDB:Q9DAM9	0.567	0.327	6.031E-9	344	0.274	0.134	Q9DAM9.pdb.gz	FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus OX=10090 GN=Fank1 PE=1 SV=1
13	PDB:8cs9A	0.829	0.184	6.097E-9	796	0.298	0.063	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
14	AFDB:A1DRY3	0.804	0.189	6.984E-9	782	0.286	0.061	A1DRY3.pdb.gz	A1DRY3_HUMAN Several ankyrin repeat protein transcript variant 2 (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
15	PDB:6jd6B	0.833	0.735	2.646E-8	192	0.274	0.240	6jd6B.pdb.gz
16	PDB:6mwqA	0.843	0.301	6.077E-8	493	0.339	0.116	6mwqA.pdb.gz
17	PDB:2dvwA	0.790	0.591	9.439E-8	229	0.321	0.236	2dvwA.pdb.gz
18	PDB:6pqpA	0.806	0.231	2.511E-7	615	0.280	0.076	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
19	PDB:1a5eA	0.653	0.699	7.736E-7	156	0.321	0.346	1a5eA.pdb.gz
20	PDB:1d9sA	0.649	0.789	1.391E-6	136	0.310	0.382	1d9sA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P42773	1.08e-120	339	168	1.000	1.000	CDN2C_HUMAN Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens OX=9606 GN=CDKN2C PE=1 SV=1
2	Q8R5G4	5.13e-103	294	168	0.929	0.929	Q8R5G4_RAT Cyclin-dependent kinase inhibitor 2C OS=Rattus norvegicus OX=10116 GN=Cdkn2c PE=1 SV=1
3	Q60772	9.08e-102	291	168	0.923	0.923	CDN2C_MOUSE Cyclin-dependent kinase 4 inhibitor C OS=Mus musculus OX=10090 GN=Cdkn2c PE=1 SV=1
4	Q60773	2.66e-40	135	166	0.429	0.434	CDN2D_MOUSE Cyclin-dependent kinase 4 inhibitor D OS=Mus musculus OX=10090 GN=Cdkn2d PE=1 SV=2
5	P55273	2.43e-38	130	166	0.423	0.428	CDN2D_HUMAN Cyclin-dependent kinase 4 inhibitor D OS=Homo sapiens OX=9606 GN=CDKN2D PE=1 SV=1
6	P42771	7.35e-24	93.2	156	0.327	0.353	CDN2A_HUMAN Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A PE=1 SV=2
7	P55272	1.49e-23	91.7	130	0.298	0.385	CDN2B_RAT Cyclin-dependent kinase 4 inhibitor B OS=Rattus norvegicus OX=10116 GN=Cdkn2b PE=2 SV=1
8	P55271	4.52e-23	90.5	130	0.298	0.385	CDN2B_MOUSE Cyclin-dependent kinase 4 inhibitor B OS=Mus musculus OX=10090 GN=Cdkn2b PE=1 SV=1
9	P42772	6.03e-23	90.5	138	0.315	0.384	CDN2B_HUMAN Cyclin-dependent kinase 4 inhibitor B OS=Homo sapiens OX=9606 GN=CDKN2B PE=1 SV=1
10	P51480	3.32e-21	86.7	168	0.286	0.286	CDN2A_MOUSE Cyclin-dependent kinase inhibitor 2A OS=Mus musculus OX=10090 GN=Cdkn2a PE=1 SV=2
11	Q9R0Z3	8.04e-20	82.8	159	0.280	0.296	CDN2A_RAT Cyclin-dependent kinase inhibitor 2A OS=Rattus norvegicus OX=10116 GN=Cdkn2a PE=2 SV=1
12	Q9SQK3	4.14e-18	81.6	315	0.304	0.162	EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB506 PE=1 SV=1
13	Q9EP71	5.82e-18	82.4	979	0.327	0.056	RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1
14	Q17490	1.27e-17	81.3	6994	0.321	0.008	Q17490_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=2
15	M9MRX4	1.94e-17	80.9	13559	0.310	0.004	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
16	X2JCM1	1.94e-17	80.9	11634	0.310	0.004	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	Q9P0K7	2.97e-17	80.1	980	0.321	0.055	RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2
18	Q12955	3.43e-17	80.1	4377	0.327	0.013	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
19	Q5GIG6	4.03e-17	79.7	834	0.292	0.059	TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus OX=10090 GN=Tnni3k PE=2 SV=4
20	O70511	6.26e-17	79.3	2622	0.333	0.021	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	6.9e-10	50.1	Ankyrin repeat
2	PF12796 Ank_2	1.5e-14	65.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	4.5e-08	43.6	Ankyrin repeat
4	PF13637 Ank_4	3e-19	80.4	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.4e-13	62.0	Ankyrin repeats (many copies)
6	PF08898 DUF1843	13	17.7	Domain of unknown function (DUF1843)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000016753

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000008795	0.998	Cyclin-dependent kinase 6
2	60711.ENSCSAP00000000963	0.996	Cyclin-dependent kinase 4
3	60711.ENSCSAP00000007517	0.975	Cyclin D3
4	60711.ENSCSAP00000007347	0.967	Cyclin D2
5	60711.ENSCSAP00000005529	0.963	Cyclin D1
6	60711.ENSCSAP00000007551	0.918	Acts as a tumor suppressor in many tumor types
7	60711.ENSCSAP00000004847	0.802	Cyclin-dependent kinase inhibitor 1B (p27, Kip1)
8	60711.ENSCSAP00000006526	0.726	Cyclin-dependent kinase inhibitor 1A (p21, Cip1)
9	60711.ENSCSAP00000005819	0.711	Cyclin-dependent kinase inhibitor 1C (p57, Kip2)
10	60711.ENSCSAP00000018836	0.673	Ras association (RalGDS/AF-6) domain family (N-terminal) member 10
11	60711.ENSCSAP00000001257	0.639	Mitogen-activated protein kinase 12
12	60711.ENSCSAP00000001593	0.637	Cyclin-dependent kinase 2
13	60711.ENSCSAP00000014131	0.632	Mitogen-activated protein kinase kinase kinase 8
14	60711.ENSCSAP00000008666	0.598	Polymerase (DNA directed), epsilon 3, accessory subunit
15	60711.ENSCSAP00000001278	0.571	Belongs to the protein kinase superfamily.
16	60711.ENSCSAP00000001725	0.566	Negative regulator in the hedgehog signaling pathway. Down- regulates GLI1-mediated transactivation of target genes. Part of a corepressor complex that acts on DNA-bound GLI1. May also act by linking GLI1 to BTRC and thereby targeting GLI1 to degradation by the proteasome. Sequesters GLI1, GLI2 and GLI3 in the cytoplasm, this effect is overcome by binding of STK36 to both SUFU and a GLI protein. Negative regulator of beta-catenin signaling. Regulates the formation of either the repressor form (GLI3R) or the activator form (GLI3A) of the full-length form of GLI3 (GLI3FL). GLI3FL is comp [...]
17	60711.ENSCSAP00000015167	0.561	Probably involved in cell proliferation and cell-cell interactions
18	60711.ENSCSAP00000013142	0.557	Calcium and integrin binding 1 (calmyrin)
19	60711.ENSCSAP00000001166	0.555	Cyclin E1
20	60711.ENSCSAP00000017504	0.553	Cyclin-dependent kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004861	1.000	cyclin-dependent protein serine/threonine kinase inhibitor activity
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048523	0.989	negative regulation of cellular process
GO:0001932	0.987	regulation of protein phosphorylation
GO:0043549	0.986	regulation of kinase activity
GO:0051726	0.985	regulation of cell cycle
GO:0009987	0.981	cellular process
GO:1904029	0.981	regulation of cyclin-dependent protein kinase activity
GO:0000079	0.956	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0010563	0.941	negative regulation of phosphorus metabolic process
GO:0042127	0.936	regulation of cell population proliferation
GO:0045936	0.919	negative regulation of phosphate metabolic process
GO:0042326	0.910	negative regulation of phosphorylation
GO:1901987	0.887	regulation of cell cycle phase transition
GO:0007346	0.876	regulation of mitotic cell cycle
GO:0010605	0.860	negative regulation of macromolecule metabolic process
GO:0044092	0.822	negative regulation of molecular function
GO:0051172	0.798	negative regulation of nitrogen compound metabolic process
GO:1902806	0.782	regulation of cell cycle G1/S phase transition
GO:0008285	0.759	negative regulation of cell population proliferation
GO:0048518	0.742	positive regulation of biological process
GO:0051128	0.719	regulation of cellular component organization
GO:0048522	0.560	positive regulation of cellular process
GO:1901990	0.560	regulation of mitotic cell cycle phase transition
GO:0032501	0.499	multicellular organismal process
GO:0008152	0.428	metabolic process
GO:0050896	0.377	response to stimulus
GO:0045786	0.374	negative regulation of cell cycle
GO:0032502	0.369	developmental process
GO:0040008	0.367	regulation of growth
GO:0051248	0.367	negative regulation of protein metabolic process
GO:2000045	0.361	regulation of G1/S transition of mitotic cell cycle
GO:0048856	0.358	anatomical structure development
GO:0043086	0.351	negative regulation of catalytic activity
GO:0071704	0.323	organic substance metabolic process
GO:0010468	0.322	regulation of gene expression
GO:0001933	0.310	negative regulation of protein phosphorylation
GO:0007275	0.303	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005829	0.996	cytosol
GO:0005654	0.943	nucleoplasm
GO:0032991	0.362	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]