StarFunc result for job id P42858

User Input

>input (1400 residues)
MATLEKLMKAFESLKSFQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQPPPQAQP
LLPQPQPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPE
FQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAP
RSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFG
NFANDNEIKVLLKAFIANLKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGLLV
PVEDEHSTLLILGVLLTLRYLVPLLQQQVKDTSLKGSFGVTRKEMEVSPSAEQLVQVYEL
TLHHTQHQDHNVVTGALELLQQLFRTPPPELLQTLTAVGGIGQLTAAKEESGGRSRSGSI
VELIAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSESRSDVSSSALTASVKDEISGELAA
SSGVSTPGSAGHDIITEQPRSQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAV
PSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQPQD
EDEEATGILPDEASEAFRNSSMALQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQE
NKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVG
AAVALHPESFFSKLYKVPLDTTEYPEEQYVSDILNYIDHGDPQVRGATAILCGTLICSIL
SRSRFHVGDWMGTIRTLTGNTFSLADCIPLLRKTLKDESSVTCKLACTAVRNCVMSLCSS
SYSELGLQLIIDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGL
LKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQADPVVAVARDQSSV
YLKLLMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRA
LTFGCCEALCLLSTAFPVCIWSLGWHCGVPPLSASDESRKSCTVGMATMILTLLSSAWFP
LDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWPALGDRALVPMVEQ
LFSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSP
KKGSEASAASRQSDTSGPVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNST
EKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMMATVCVQQLLKTLF
GTNLASQFDGLSSNPSKSQGRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQ
AEQENDTSGWFDVLQKVSTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6x9oA	0.625	0.361	2.198E-85	2425	0.626	0.362	6x9oA.pdb.gz
2	PDB:6yejA	0.611	0.419	6.323E-78	2046	0.616	0.422	6yejA.pdb.gz
3	PDB:6ez8A	0.611	0.364	1.168E-76	2353	0.616	0.367	6ez8A.pdb.gz
4	AFDB:Q8T069	0.196	0.431	1.268E-11	620	0.085	0.192	Q8T069.pdb.gz	Q8T069_DROME LD23533p OS=Drosophila melanogaster OX=7227 GN=htt PE=2 SV=1
5	PDB:1qgkA	0.254	0.362	8.776E-8	876	0.088	0.140	1qgkA.pdb.gz
6	PDB:3w3uA	0.195	0.240	5.012E-7	1030	0.092	0.125	3w3uA.pdb.gz
7	PDB:3w3zA	0.172	0.219	3.073E-6	1013	0.091	0.126	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
8	PDB:3nd2A	0.276	0.408	3.804E-6	861	0.093	0.151	3nd2A.pdb.gz
9	PDB:4a0cA	0.247	0.292	4.709E-6	1155	0.090	0.109	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
10	PDB:6xu2A	0.236	0.285	1.274E-5	1091	0.089	0.114	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
11	PDB:4jlqA	0.253	0.386	1.522E-5	840	0.086	0.143	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
12	AFDB:Q9VS24	0.121	0.159	1.698E-2	994	0.054	0.075	Q9VS24.pdb.gz	MELT_DROME Protein melted OS=Drosophila melanogaster OX=7227 GN=melt PE=1 SV=2
13	AFDB:Q8GUP3	0.122	0.180	2.696E-2	873	0.055	0.088	Q8GUP3.pdb.gz	PDS5C_ARATH Sister chromatid cohesion protein PDS5 homolog C OS=Arabidopsis thaliana OX=3702 GN=PDS5C PE=1 SV=1
14	AFDB:Q9LJD8	0.141	0.143	4.934E-2	1368	0.103	0.105	Q9LJD8.pdb.gz	M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=M3KE1 PE=1 SV=1
15	AFDB:Q9UIF8	0.059	0.047	7.560E-2	2168	0.109	0.070	Q9UIF8.pdb.gz	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
16	AFDB:Q8T2I8	0.112	0.126	9.697E-2	1167	0.105	0.126	Q8T2I8.pdb.gz	SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum OX=44689 GN=sepA PE=2 SV=1
17	AFDB:Q1MTM9	0.085	0.110	2.046E-1	977	0.076	0.110	Q1MTM9.pdb.gz	YFN1_SCHPO Uncharacterized transcriptional regulatory protein C1327.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1327.01c PE=1 SV=2
18	AFDB:Q584T3	0.100	0.160	2.120E-1	775	0.074	0.133	Q584T3.pdb.gz	Q584T3_TRYB2 Mitochondrial oligo U binding protein TBRGG1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.600 PE=4 SV=1
19	AFDB:Q9U9A9	0.108	0.131	2.359E-1	1100	0.051	0.065	Q9U9A9.pdb.gz	Q9U9A9_DROME Tuberous sclerosis gene product-1 homolog OS=Drosophila melanogaster OX=7227 GN=Tsc1 PE=2 SV=1
20	AFDB:Q6TRW4	0.091	0.090	3.614E-1	1447	0.067	0.065	Q6TRW4.pdb.gz	PDS5B_RAT Sister chromatid cohesion protein PDS5 homolog B OS=Rattus norvegicus OX=10116 GN=Pds5b PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0ZJI1	0.0	2179	3053	0.779	0.357	H0ZJI1_TAEGU Huntingtin OS=Taeniopygia guttata OX=59729 GN=HTT PE=3 SV=2
2	O42269	0.0	1805	3121	0.681	0.306	O42269_DANRE Huntingtin OS=Danio rerio OX=7955 GN=HD PE=1 SV=3
3	P42858	0.0	2865	3142	1.000	0.446	HD_HUMAN Huntingtin OS=Homo sapiens OX=9606 GN=HTT PE=1 SV=2
4	P42859	0.0	2420	3119	0.866	0.389	HD_MOUSE Huntingtin OS=Mus musculus OX=10090 GN=Htt PE=1 SV=2
5	P51111	0.0	2394	3110	0.860	0.387	HD_RAT Huntingtin OS=Rattus norvegicus OX=10116 GN=Htt PE=1 SV=1
6	Q8T069	4.98e-21	101	620	0.055	0.124	Q8T069_DROME LD23533p OS=Drosophila melanogaster OX=7227 GN=htt PE=2 SV=1
7	Q9U999	1.88e-20	101	3584	0.055	0.021	Q9U999_DROME Huntingtin homolog OS=Drosophila melanogaster OX=7227 GN=htt PE=2 SV=1
8	Q9V3N4	1.96e-20	101	3583	0.055	0.021	Q9V3N4_DROME Huntingtin, isoform A OS=Drosophila melanogaster OX=7227 GN=htt PE=1 SV=1
9	Q76P24	7.24e-19	96.3	3095	0.047	0.021	HD_DICDI HD protein homolog OS=Dictyostelium discoideum OX=44689 GN=htt PE=3 SV=1
10	D2CTI5	0.075	35.0	40	0.016	0.550	D2CTI5_MACMU Huntingtin (Fragment) OS=Macaca mulatta OX=9544 PE=4 SV=1
11	Q9JKS6	9.8	33.1	5085	0.021	0.006	PCLO_RAT Protein piccolo OS=Rattus norvegicus OX=10116 GN=Pclo PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	2.7	19.4	Armadillo/beta-catenin-like repeat
2	PF02985 HEAT	5.8e-05	34.0	HEAT repeat
3	PF13646 HEAT_2	0.00063	31.4	HEAT repeats
4	PF13513 HEAT_EZ	0.032	26.1	HEAT-like repeat
5	PF12755 Vac14_Fab1_bd	1.6	20.7	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347184

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262367	0.999	CREB-binding protein
2	9606.ENSP00000306253	0.999	Inositol 1,4,5-trisphosphate receptor type 1
3	9606.ENSP00000334002	0.998	Huntingtin-associated protein 1
4	9606.ENSP00000358518	0.998	Coagulation factor VIII-associated 2
5	9606.ENSP00000368022	0.998	Optineurin
6	9606.ENSP00000269305	0.997	Cellular tumor antigen p53
7	9606.ENSP00000403397	0.997	Palmitoyltransferase ZDHHC17
8	9606.ENSP00000229239	0.995	Glyceraldehyde-3-phosphate dehydrogenase
9	9606.ENSP00000386759	0.994	Histone-lysine N-methyltransferase SETD2
10	9606.ENSP00000329357	0.993	Transcription factor Sp1
11	9606.ENSP00000311816	0.992	RE1-silencing transcription factor
12	9606.ENSP00000355231	0.992	Beclin-1
13	9606.ENSP00000300935	0.989	Ras-related protein Rab-8A
14	9606.ENSP00000252996	0.988	Transcription initiation factor TFIID subunit 4
15	9606.ENSP00000382428	0.987	Disks large homolog 4
16	9606.ENSP00000449089	0.987	Dynamin-1-like protein
17	9606.ENSP00000336747	0.986	Huntingtin-interacting protein 1
18	9606.ENSP00000386458	0.985	Pre-mRNA-processing factor 40 homolog A
19	9606.ENSP00000384474	0.984	Huntingtin-interacting protein K
20	9606.ENSP00000356448	0.983	Nucleoprotein TPR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.965	enzyme binding
GO:0019900	0.951	kinase binding
GO:0042802	0.929	identical protein binding
GO:0005522	0.921	profilin binding
GO:0048487	0.921	beta-tubulin binding
GO:0002039	0.920	p53 binding
GO:0031072	0.919	heat shock protein binding
GO:0044325	0.917	transmembrane transporter binding
GO:0045505	0.883	dynein intermediate chain binding
GO:0034452	0.881	dynactin binding
GO:0003824	0.306	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.944	biological regulation
GO:0050794	0.930	regulation of cellular process
GO:0009987	0.926	cellular process
GO:0019222	0.804	regulation of metabolic process
GO:0065009	0.801	regulation of molecular function
GO:0060255	0.786	regulation of macromolecule metabolic process
GO:0048518	0.773	positive regulation of biological process
GO:0080090	0.765	regulation of primary metabolic process
GO:0051171	0.759	regulation of nitrogen compound metabolic process
GO:0032501	0.755	multicellular organismal process
GO:0051179	0.666	localization
GO:0048522	0.609	positive regulation of cellular process
GO:0048856	0.560	anatomical structure development
GO:0051234	0.493	establishment of localization
GO:0007275	0.471	multicellular organism development
GO:0006810	0.468	transport
GO:0071840	0.458	cellular component organization or biogenesis
GO:0050896	0.429	response to stimulus
GO:0051641	0.426	cellular localization
GO:0007017	0.413	microtubule-based process
GO:0051656	0.402	establishment of organelle localization
GO:0051649	0.358	establishment of localization in cell
GO:0051246	0.354	regulation of protein metabolic process
GO:0031323	0.347	regulation of cellular metabolic process
GO:0016043	0.343	cellular component organization
GO:0048519	0.338	negative regulation of biological process
GO:0050790	0.324	regulation of catalytic activity
GO:0007399	0.306	nervous system development
GO:0007417	0.303	central nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0045202	0.998	synapse
GO:0030424	0.998	axon
GO:0031410	0.998	cytoplasmic vesicle
GO:0005829	0.997	cytosol
GO:0016020	0.996	membrane
GO:0005654	0.996	nucleoplasm
GO:0012505	0.993	endomembrane system
GO:0032991	0.982	protein-containing complex
GO:0005856	0.889	cytoskeleton
GO:0005783	0.848	endoplasmic reticulum
GO:0031090	0.813	organelle membrane
GO:0015630	0.813	microtubule cytoskeleton
GO:0036477	0.802	somatodendritic compartment
GO:0048471	0.761	perinuclear region of cytoplasm
GO:0030425	0.715	dendrite
GO:0005815	0.712	microtubule organizing center
GO:0098794	0.701	postsynapse
GO:0016234	0.690	inclusion body
GO:0005773	0.610	vacuole
GO:0012506	0.567	vesicle membrane
GO:0005794	0.566	Golgi apparatus
GO:0030659	0.561	cytoplasmic vesicle membrane
GO:0005814	0.551	centriole
GO:0005768	0.547	endosome
GO:0098793	0.460	presynapse
GO:0005776	0.445	autophagosome
GO:0005770	0.353	late endosome
GO:0005769	0.342	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]