StarFunc result for job id P42898

User Input

>input (656 residues)
MVNEARGNSSLNPCLEGSASSGSESSKDSSRCSTPGLDPERHERLREKMRRRLESGDKWF
SLEFFPPRTAEGAVNLISRFDRMAAGGPLYIDVTWHPAGDPGSDKETSSMMIASTAVNYC
GLETILHMTCCRQRLEEITGHLHKAKQLGLKNIMALRGDPIGDQWEEEEGGFNYAVDLVK
HIRSEFGDYFDICVAGYPKGHPEAGSFEADLKHLKEKVSAGADFIITQLFFEADTFFRFV
KACTDMGITCPIVPGIFPIQGYHSLRQLVKLSKLEVPQEIKDVIEPIKDNDAAIRNYGIE
LAVSLCQELLASGLVPGLHFYTLNREMATTEVLKRLGMWTEDPRRPLPWALSAHPKRREE
DVRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPKEELLKM
WGEELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWNDEPLAAETSLLKEELLRVNRQGIL
TINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELRVNYHL
VNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIERWGKLYE
EESPSRTIIQYIHDNYFLVNLVDNDFPLDNCLWQVVEDTLELLNRPTQNARETEAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A7E8	0.943	0.890	0.000	695	0.881	0.832	D4A7E8.pdb.gz	D4A7E8_RAT Methylenetetrahydrofolate reductase OS=Rattus norvegicus OX=10116 GN=Mthfr PE=3 SV=2
2	AFDB:P42898	1.000	1.000	0.000	656	1.000	1.000	P42898.pdb.gz	MTHR_HUMAN Methylenetetrahydrofolate reductase (NADPH) OS=Homo sapiens OX=9606 GN=MTHFR PE=1 SV=3
3	PDB:6fcxA	0.844	0.926	9.758E-104	596	0.892	0.982	6fcxA.pdb.gz	Structural basis for the regulation of human 5,10-methylenetetrahydrofolate reductase by phosphorylation and S-adenosylmethionine inhibition.
4	AFDB:O80585	0.851	0.937	8.267E-71	594	0.398	0.439	O80585.pdb.gz	MTHR2_ARATH Methylenetetrahydrofolate reductase (NADH) 2 OS=Arabidopsis thaliana OX=3702 GN=MTHFR2 PE=1 SV=2
5	AFDB:Q9SE60	0.846	0.935	3.632E-70	592	0.395	0.438	Q9SE60.pdb.gz	MTHR1_ARATH Methylenetetrahydrofolate reductase (NADH) 1 OS=Arabidopsis thaliana OX=3702 GN=MTHFR1 PE=1 SV=1
6	AFDB:Q5B0P7	0.817	0.853	2.909E-64	627	0.402	0.421	Q5B0P7.pdb.gz	Q5B0P7_EMENI Methylenetetrahydrofolate reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05883 PE=3 SV=1
7	AFDB:Q10258	0.782	0.845	1.210E-63	603	0.377	0.410	Q10258.pdb.gz	MTHR1_SCHPO Methylenetetrahydrofolate reductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=met9 PE=1 SV=1
8	AFDB:P53128	0.815	0.888	8.231E-61	600	0.381	0.417	P53128.pdb.gz	MTHR2_YEAST Methylenetetrahydrofolate reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET13 PE=1 SV=2
9	AFDB:O74927	0.404	0.413	7.341E-50	641	0.341	0.349	O74927.pdb.gz	MTHR2_SCHPO Methylenetetrahydrofolate reductase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=met11 PE=2 SV=2
10	AFDB:P46151	0.410	0.409	1.670E-48	657	0.338	0.338	P46151.pdb.gz	MTHR1_YEAST Methylenetetrahydrofolate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET12 PE=1 SV=2
11	AFDB:Q5AU15	0.403	0.387	2.732E-46	684	0.328	0.314	Q5AU15.pdb.gz	Q5AU15_EMENI Methylenetetrahydrofolate reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08215 PE=3 SV=1
12	PDB:6peyB	0.398	0.877	9.977E-23	290	0.142	0.321	6peyB.pdb.gz	Examination of Asp120Ala a Chemically Important Novel Mutation in the Enzyme Mthylenetetrahydrofolate Reductase
13	PDB:1oqfA	0.233	0.460	1.106E-6	290	0.056	0.128	1oqfA.pdb.gz
14	PDB:1nqkA	0.268	0.461	5.724E-6	345	0.052	0.099	1nqkA.pdb.gz
15	PDB:2duaA	0.244	0.496	1.622E-5	283	0.055	0.127	2duaA.pdb.gz	Structure and Kinetics of Phosphonopyruvate Hydrolase from Voriovorax sp. Pal2: New Insight into the Divergence of Catalysis within the PEP Mutase/Isocitrate Lyase Superfamily
16	PDB:6ofuB	0.213	0.452	2.964E-5	264	0.061	0.152	6ofuB.pdb.gz	Structural and Functional Characterization of YdjI, an Aldolase of Unknown Specificity inEscherichia coliK12.
17	PDB:3ivtB	0.243	0.372	3.691E-5	400	0.050	0.083	3ivtB.pdb.gz	Crystal structure and functional analysis of homocitrate synthase, an essential enzyme in lysine biosynthesis.
18	PDB:5hmsA	0.239	0.429	4.854E-5	330	0.047	0.094	5hmsA.pdb.gz	Structural studies of substrate and product complexes of 5-aminolaevulinic acid dehydratase from humans, Escherichia coli and the hyperthermophile Pyrobaculum calidifontis.
19	PDB:1gvfB	0.212	0.431	5.128E-5	275	0.064	0.153	1gvfB.pdb.gz	Structure of Tagatose-1,6-Bisphosphate Aldolase; Insight Into Chiral Discrimination, Mechanism and Specificity of Class II Aldolases
20	PDB:1igwC	0.267	0.393	6.744E-5	416	0.046	0.072	1igwC.pdb.gz	The structure and domain organization of Escherichia coli isocitrate lyase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A4C5	0.0	1166	695	0.857	0.809	A0A8I6A4C5_RAT Methylenetetrahydrofolate reductase OS=Rattus norvegicus OX=10116 GN=Mthfr PE=3 SV=1
2	A0A8I6A5Q6	0.0	1166	654	0.857	0.859	A0A8I6A5Q6_RAT Methylenetetrahydrofolate reductase OS=Rattus norvegicus OX=10116 GN=Mthfr PE=3 SV=1
3	D4A7E8	0.0	1167	660	0.857	0.852	D4A7E8_RAT Methylenetetrahydrofolate reductase OS=Rattus norvegicus OX=10116 GN=Mthfr PE=3 SV=2
4	P42898	0.0	1360	656	1.000	1.000	MTHR_HUMAN Methylenetetrahydrofolate reductase (NADPH) OS=Homo sapiens OX=9606 GN=MTHFR PE=1 SV=3
5	Q9WU20	0.0	1205	654	0.899	0.902	MTHR_MOUSE Methylenetetrahydrofolate reductase (NADPH) OS=Mus musculus OX=10090 GN=Mthfr PE=1 SV=2
6	Q9SE60	7.18e-176	515	592	0.396	0.439	MTHR1_ARATH Methylenetetrahydrofolate reductase (NADH) 1 OS=Arabidopsis thaliana OX=3702 GN=MTHFR1 PE=1 SV=1
7	O80585	8.16e-175	512	594	0.395	0.436	MTHR2_ARATH Methylenetetrahydrofolate reductase (NADH) 2 OS=Arabidopsis thaliana OX=3702 GN=MTHFR2 PE=1 SV=2
8	Q5B0P7	1.66e-170	503	627	0.407	0.426	Q5B0P7_EMENI Methylenetetrahydrofolate reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05883 PE=3 SV=1
9	Q10258	1.94e-157	468	603	0.378	0.411	MTHR1_SCHPO Methylenetetrahydrofolate reductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=met9 PE=1 SV=1
10	P53128	4.01e-155	462	600	0.383	0.418	MTHR2_YEAST Methylenetetrahydrofolate reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET13 PE=1 SV=2
11	O74927	3.13e-109	345	641	0.348	0.356	MTHR2_SCHPO Methylenetetrahydrofolate reductase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=met11 PE=2 SV=2
12	Q5AU15	1.06e-88	292	684	0.334	0.320	Q5AU15_EMENI Methylenetetrahydrofolate reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08215 PE=3 SV=1
13	P46151	2.09e-53	196	657	0.174	0.174	MTHR1_YEAST Methylenetetrahydrofolate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET12 PE=1 SV=2
14	P0AEZ1	3.76e-41	153	296	0.152	0.338	METF_ECOLI 5,10-methylenetetrahydrofolate reductase OS=Escherichia coli (strain K12) OX=83333 GN=metF PE=1 SV=1
15	O14100	2.3	33.9	938	0.037	0.026	ZDS1_SCHPO Protein zds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zds1 PE=1 SV=2
16	O32149	2.5	33.5	412	0.037	0.058	ALLC_BACSU Allantoate amidohydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=pucF PE=2 SV=1
17	Q12232	2.7	33.5	587	0.053	0.060	SLP1_YEAST Uncharacterized protein SLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLP1 PE=1 SV=1
18	Q9VRJ1	3.9	33.1	1012	0.041	0.027	SYAM_DROME Alanine--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=AlaRS-m PE=2 SV=1
19	Q24037	4.1	33.1	743	0.023	0.020	Q24037_DROME Nervy OS=Drosophila melanogaster OX=7227 GN=nvy PE=2 SV=1
20	A0A0B4KFZ8	4.5	33.1	742	0.023	0.020	A0A0B4KFZ8_DROME Nervy, isoform B OS=Drosophila melanogaster OX=7227 GN=nvy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02219 MTHFR	1.9e-118	406.6	Methylenetetrahydrofolate reductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012610

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000019271	0.999	Catalyzes the transfer of a methyl group from methyl- cobalamin to homocysteine, yielding enzyme-bound cob(I)alamin and methionine. Subsequently, remethylates the cofactor using methyltetrahydrofolate
2	9593.ENSGGOP00000003046	0.998	Serine hydroxymethyltransferase
3	9593.ENSGGOP00000018066	0.993	Serine hydroxymethyltransferase
4	9593.ENSGGOP00000018507	0.979	Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase
5	9593.ENSGGOP00000014952	0.978	Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like
6	9593.ENSGGOP00000017517	0.967	The glycine cleavage system catalyzes the degradation of glycine
7	9593.ENSGGOP00000004425	0.952	Glycine cleavage system P protein
8	9593.ENSGGOP00000007397	0.923	Betaine--homocysteine S-methyltransferase
9	9593.ENSGGOP00000016141	0.889	Cystathionine gamma-lyase
10	9593.ENSGGOP00000021489	0.887	Thymidylate synthetase
11	9593.ENSGGOP00000003155	0.877	Betaine--homocysteine S-methyltransferase 2
12	9593.ENSGGOP00000000929	0.876	Folylpolyglutamate synthase
13	9593.ENSGGOP00000000229	0.868	Glycine cleavage system H protein
14	9593.ENSGGOP00000004838	0.805	S-adenosylmethionine synthase
15	9593.ENSGGOP00000005739	0.805	S-adenosylmethionine synthase
16	9593.ENSGGOP00000000944	0.795	5-methyltetrahydrofolate-homocysteine methyltransferase reductase
17	9593.ENSGGOP00000010215	0.786	Trifunctional purine biosynthetic protein adenosine-3
18	9593.ENSGGOP00000019442	0.780	Uncharacterized protein
19	9593.ENSGGOP00000003151	0.773	Dimethylglycine dehydrogenase
20	9593.ENSGGOP00000015641	0.769	Sarcosine dehydrogenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004489	1.000	methylenetetrahydrofolate reductase (NAD(P)H) activity
GO:0050660	1.000	flavin adenine dinucleotide binding
GO:0017076	0.897	purine nucleotide binding
GO:0030554	0.846	adenyl nucleotide binding
GO:0050661	0.814	NADP binding
GO:0005515	0.729	protein binding
GO:0072341	0.508	modified amino acid binding
GO:0044877	0.409	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:1901564	0.977	organonitrogen compound metabolic process
GO:1901360	0.928	organic cyclic compound metabolic process
GO:0046483	0.917	heterocycle metabolic process
GO:0006725	0.913	cellular aromatic compound metabolic process
GO:0043436	0.896	oxoacid metabolic process
GO:0019752	0.889	carboxylic acid metabolic process
GO:0006760	0.826	folic acid-containing compound metabolic process
GO:0046653	0.773	tetrahydrofolate metabolic process
GO:0050896	0.686	response to stimulus
GO:0006520	0.658	amino acid metabolic process
GO:0006790	0.648	sulfur compound metabolic process
GO:1901605	0.632	alpha-amino acid metabolic process
GO:0000096	0.611	sulfur amino acid metabolic process
GO:0042221	0.509	response to chemical
GO:0006950	0.424	response to stress
GO:0065007	0.347	biological regulation
GO:0009058	0.325	biosynthetic process
GO:1901576	0.320	organic substance biosynthetic process
GO:0044249	0.320	cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0030054	0.371	cell junction
GO:0043231	0.345	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.5.1.20	1.000	methylenetetrahydrofolate reductase [NAD(P)H].

[back to server]