StarFunc result for job id P43007

User Input

>input (532 residues)
MEKSNETNGYLDSAQAGPAAGPGAPGTAAGRARRCAGFLRRQALVLLTVSGVLAGAGLGA
ALRGLSLSRTQVTYLAFPGEMLLRMLRMIILPLVVCSLVSGAASLDASCLGRLGGIAVAY
FGLTTLSASALAVALAFIIKPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFP
SNLVVAAFRTYATDYKVVTQNSSSGNVTHEKIPIGTEIEGMNILGLVLFALVLGVALKKL
GSEGEDLIRFFNSLNEATMVLVSWIMWYVPVGIMFLVGSKIVEMKDIIVLVTSLGKYIFA
SILGHVIHGGIVLPLIYFVFTRKNPFRFLLGLLAPFATAFATCSSSATLPSMMKCIEENN
GVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNVELNAGQIFTILVTATASSVGA
AGVPAGGVLTIAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQK
ATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43007	1.000	1.000	1.345E-70	532	1.000	1.000	P43007.pdb.gz	SATT_HUMAN Neutral amino acid transporter A OS=Homo sapiens OX=9606 GN=SLC1A4 PE=1 SV=1
2	AFDB:O35874	0.938	0.938	9.515E-64	532	0.898	0.898	O35874.pdb.gz	SATT_MOUSE Neutral amino acid transporter A OS=Mus musculus OX=10090 GN=Slc1a4 PE=1 SV=1
3	AFDB:Q15758	0.835	0.821	6.879E-46	541	0.592	0.582	Q15758.pdb.gz	AAAT_HUMAN Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5 PE=1 SV=2
4	AFDB:P51912	0.803	0.774	9.853E-44	553	0.586	0.564	P51912.pdb.gz	AAAT_MOUSE Neutral amino acid transporter B(0) OS=Mus musculus OX=10090 GN=Slc1a5 PE=1 SV=2
5	AFDB:D3ZJ25	0.818	0.787	3.846E-43	554	0.564	0.542	D3ZJ25.pdb.gz	AAAT_RAT Neutral amino acid transporter B(0) OS=Rattus norvegicus OX=10116 GN=Slc1a5 PE=1 SV=4
6	AFDB:P24942	0.806	0.790	5.179E-40	543	0.430	0.422	P24942.pdb.gz	EAA1_RAT Excitatory amino acid transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc1a3 PE=1 SV=2
7	PDB:7p4iA	0.416	0.513	4.986E-39	428	0.799	0.993	7p4iA.pdb.gz
8	AFDB:D7RVR8	0.790	0.767	1.073E-38	548	0.404	0.392	D7RVR8.pdb.gz	D7RVR8_DANRE Amino acid transporter OS=Danio rerio OX=7955 GN=slc1a2a PE=2 SV=1
9	AFDB:P51906	0.810	0.824	3.673E-38	523	0.427	0.434	P51906.pdb.gz	EAA3_MOUSE Excitatory amino acid transporter 3 OS=Mus musculus OX=10090 GN=Slc1a1 PE=1 SV=2
10	AFDB:P48664	0.818	0.773	6.502E-38	564	0.421	0.397	P48664.pdb.gz	EAA4_HUMAN Excitatory amino acid transporter 4 OS=Homo sapiens OX=9606 GN=SLC1A6 PE=1 SV=1
11	AFDB:Q10901	0.796	0.841	1.434E-37	503	0.370	0.392	Q10901.pdb.gz	EAA1_CAEEL Excitatory amino acid transporter OS=Caenorhabditis elegans OX=6239 GN=glt-1 PE=1 SV=2
12	PDB:6mpbB	0.791	0.939	1.646E-36	446	0.549	0.655	6mpbB.pdb.gz	Cryo-EM structures of the human glutamine transporter SLC1A5 (ASCT2) in the outward-facing conformation.
13	PDB:7xr4A	0.435	0.542	4.592E-32	425	0.382	0.478	7xr4A.pdb.gz	Structural basis of ligand binding modes of human EAAT2.
14	PDB:7nsgA	0.419	0.516	9.347E-30	430	0.387	0.479	7nsgA.pdb.gz	Structure of human excitatory amino acid transporter 3 (EAAT3) in complex with HIP-B
15	PDB:6x15A	0.414	0.523	1.138E-18	419	0.254	0.322	6x15A.pdb.gz	Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.
16	PDB:7p5cA	0.085	0.109	2.919E-2	392	0.109	0.148	7p5cA.pdb.gz
17	PDB:7p5jA	0.110	0.136	1.140E-1	399	0.105	0.140	7p5jA.pdb.gz
18	PDB:1pw4A	0.099	0.109	1.848E-1	434	0.107	0.131	1pw4A.pdb.gz
19	PDB:6oopA	0.130	0.159	3.271E-1	392	0.109	0.148	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.
20	PDB:6s4mA	0.108	0.128	3.271E-1	426	0.139	0.174	6s4mA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35874	0.0	944	532	0.898	0.898	SATT_MOUSE Neutral amino acid transporter A OS=Mus musculus OX=10090 GN=Slc1a4 PE=1 SV=1
2	P43007	0.0	1067	532	1.000	1.000	SATT_HUMAN Neutral amino acid transporter A OS=Homo sapiens OX=9606 GN=SLC1A4 PE=1 SV=1
3	P51912	0.0	563	553	0.594	0.571	AAAT_MOUSE Neutral amino acid transporter B(0) OS=Mus musculus OX=10090 GN=Slc1a5 PE=1 SV=2
4	Q15758	0.0	526	541	0.553	0.543	AAAT_HUMAN Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5 PE=1 SV=2
5	D3ZJ25	4.87e-174	504	555	0.577	0.553	AAAT_RAT Neutral amino acid transporter B(0) OS=Rattus norvegicus OX=10116 GN=Slc1a5 PE=1 SV=4
6	Q9Z1J7	1.01e-170	495	539	0.566	0.558	Q9Z1J7_RAT Amino acid transporter OS=Rattus norvegicus OX=10116 GN=Slc1a5 PE=1 SV=1
7	A0A8I6GC77	5.93e-170	494	552	0.571	0.551	A0A8I6GC77_RAT Amino acid transporter OS=Rattus norvegicus OX=10116 GN=Slc1a5 PE=3 SV=1
8	M0QXM4	4.74e-158	456	365	0.444	0.647	M0QXM4_HUMAN Amino acid transporter OS=Homo sapiens OX=9606 GN=SLC1A5 PE=1 SV=1
9	P48664	3.57e-144	428	564	0.429	0.404	EAA4_HUMAN Excitatory amino acid transporter 4 OS=Homo sapiens OX=9606 GN=SLC1A6 PE=1 SV=1
10	P56564	7.19e-144	427	543	0.434	0.425	EAA1_MOUSE Excitatory amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc1a3 PE=1 SV=2
11	P43003	8.28e-144	426	542	0.419	0.411	EAA1_HUMAN Excitatory amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC1A3 PE=1 SV=1
12	P24942	1.33e-143	426	543	0.430	0.422	EAA1_RAT Excitatory amino acid transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc1a3 PE=1 SV=2
13	P46411	1.69e-143	426	542	0.417	0.410	EAA1_BOVIN Excitatory amino acid transporter 1 OS=Bos taurus OX=9913 GN=SLC1A3 PE=2 SV=1
14	O35544	2.14e-143	426	561	0.432	0.410	EAA4_MOUSE Excitatory amino acid transporter 4 OS=Mus musculus OX=10090 GN=Slc1a6 PE=1 SV=1
15	O35921	4.07e-142	423	561	0.427	0.405	EAA4_RAT Excitatory amino acid transporter 4 OS=Rattus norvegicus OX=10116 GN=Slc1a6 PE=1 SV=1
16	P31597	3.98e-137	409	524	0.412	0.418	EAA3_RABIT Excitatory amino acid transporter 3 OS=Oryctolagus cuniculus OX=9986 GN=SLC1A1 PE=1 SV=1
17	P51907	4.02e-134	401	523	0.421	0.428	EAA3_RAT Excitatory amino acid transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc1a1 PE=1 SV=1
18	Q95135	1.11e-133	400	524	0.406	0.412	EAA3_BOVIN Excitatory amino acid transporter 3 OS=Bos taurus OX=9913 GN=SLC1A1 PE=2 SV=1
19	P51906	2.98e-133	399	523	0.419	0.426	EAA3_MOUSE Excitatory amino acid transporter 3 OS=Mus musculus OX=10090 GN=Slc1a1 PE=1 SV=2
20	O00341	4.37e-132	397	560	0.410	0.389	EAA5_HUMAN Excitatory amino acid transporter 5 OS=Homo sapiens OX=9606 GN=SLC1A7 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00375 SDF	3.3e-116	400.2	Sodium:dicarboxylate symporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234256

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419945	0.976	Syncytin-1
2	9606.ENSP00000256689	0.791	Sodium-coupled neutral amino acid transporter 2
3	9606.ENSP00000261622	0.784	Large neutral amino acids transporter small subunit 1
4	9606.ENSP00000320378	0.739	Large neutral amino acids transporter small subunit 2
5	9606.ENSP00000370128	0.707	High affinity cationic amino acid transporter 1
6	9606.ENSP00000449756	0.686	Sodium-coupled neutral amino acid transporter 1
7	9606.ENSP00000365686	0.677	Solute carrier family 15 member 1
8	9606.ENSP00000280612	0.674	Cystine/glutamate transporter
9	9606.ENSP00000461382	0.673	Large neutral amino acids transporter small subunit 4
10	9606.ENSP00000260649	0.670	Neutral and basic amino acid transport protein rBAT
11	9606.ENSP00000455064	0.670	Y+L amino acid transporter 2
12	9606.ENSP00000367123	0.664	4F2 cell-surface antigen heavy chain
13	9606.ENSP00000389843	0.643	Sodium-coupled neutral amino acid transporter 4
14	9606.ENSP00000305302	0.626	Sodium-dependent neutral amino acid transporter B(0)AT1
15	9606.ENSP00000380666	0.626	Y+L amino acid transporter 1
16	9606.ENSP00000367229	0.624	Centrosomal protein of 68 kDa
17	9606.ENSP00000356562	0.618	Xenotropic and polytropic retrovirus receptor 1
18	9606.ENSP00000249016	0.604	Melanin-concentrating hormone receptor 1
19	9606.ENSP00000470801	0.591	Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+)
20	9606.ENSP00000004531	0.587	Cationic amino acid transporter 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901702	1.000	salt transmembrane transporter activity
GO:0015179	1.000	L-amino acid transmembrane transporter activity
GO:0015175	1.000	neutral L-amino acid transmembrane transporter activity
GO:0015172	1.000	acidic amino acid transmembrane transporter activity
GO:0015075	0.995	monoatomic ion transmembrane transporter activity
GO:0015318	0.994	inorganic molecular entity transmembrane transporter activity
GO:0015291	0.977	secondary active transmembrane transporter activity
GO:0008324	0.976	monoatomic cation transmembrane transporter activity
GO:0022890	0.972	inorganic cation transmembrane transporter activity
GO:0015294	0.969	solute:monoatomic cation symporter activity
GO:0015081	0.948	sodium ion transmembrane transporter activity
GO:0015183	0.933	L-aspartate transmembrane transporter activity
GO:0015370	0.924	solute:sodium symporter activity
GO:0022889	0.913	serine transmembrane transporter activity
GO:0005488	0.884	binding
GO:0005343	0.842	organic acid:sodium symporter activity
GO:0005515	0.802	protein binding
GO:0005416	0.736	amino acid:monoatomic cation symporter activity
GO:0042887	0.718	amide transmembrane transporter activity
GO:0005283	0.715	amino acid:sodium symporter activity
GO:0005313	0.580	L-glutamate transmembrane transporter activity
GO:0008509	0.561	monoatomic anion transmembrane transporter activity
GO:0015501	0.410	glutamate:sodium symporter activity
GO:1901682	0.404	sulfur compound transmembrane transporter activity
GO:0000099	0.320	sulfur amino acid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051179	0.995	localization
GO:0071705	0.993	nitrogen compound transport
GO:0009987	0.989	cellular process
GO:0046942	0.988	carboxylic acid transport
GO:1905039	0.968	carboxylic acid transmembrane transport
GO:0003333	0.962	amino acid transmembrane transport
GO:0015804	0.956	neutral amino acid transport
GO:0015807	0.955	L-amino acid transport
GO:0098657	0.921	import into cell
GO:0098739	0.919	import across plasma membrane
GO:0089718	0.849	amino acid import across plasma membrane
GO:1902475	0.837	L-alpha-amino acid transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0016020	0.999	membrane
GO:0043226	0.994	organelle
GO:0005886	0.987	plasma membrane
GO:0043227	0.922	membrane-bounded organelle
GO:0005576	0.912	extracellular region
GO:0070062	0.843	extracellular exosome
GO:0043229	0.813	intracellular organelle
GO:0043228	0.393	non-membrane-bounded organelle
GO:0098590	0.315	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.948	Na(+)(in) = Na(+)(out)
RHEA:35031	0.913	L-serine(in) = L-serine(out)
RHEA:66336	0.580	L-glutamate(out) = L-glutamate(in)
RHEA:29031	0.410	L-glutamate(in) + 2 Na(+)(in) = L-glutamate(out) + 2 Na(+)(out)

[back to server]