StarFunc result for job id P43026

User Input

>input (501 residues)
MRLPKLLTFLLWYLAWLDLEFICTVLGAPDLGQRPQGTRPGLAKAEAKERPPLARNVFRP
GGHSYGGGATNANARAKGGTGQTGGLTQPKKDEPKKLPPRPGGPEPKPGHPPQTRQATAR
TVTPKGQLPGGKAPPKAGSVPSSFLLKKAREPGPPREPKEPFRPPPITPHEYMLSLYRTL
SDADRKGGNSSVKLEAGLANTITSFIDKGQDDRGPVVRKQRYVFDISALEKDGLLGAELR
ILRKKPSDTAKPAAPGGGRAAQLKLSSCPSGRQPASLLDVRSVPGLDGSGWEVFDIWKLF
RNFKNSAQLCLELEAWERGRAVDLRGLGFDRAARQVHEKALFLVFGRTKKRDLFFNEIKA
RSGQDDKTVYEYLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIA
PLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFID
SANNVVYKQYEDMVVESCGCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43026	1.000	1.000	3.980E-88	501	1.000	1.000	P43026.pdb.gz	GDF5_HUMAN Growth/differentiation factor 5 OS=Homo sapiens OX=9606 GN=GDF5 PE=1 SV=4
2	AFDB:P85857	0.600	0.737	1.400E-40	404	0.385	0.478	P85857.pdb.gz	GDF6A_DANRE Growth/differentiation factor 6-A OS=Danio rerio OX=7955 GN=gdf6a PE=1 SV=1
3	AFDB:F1NUT2	0.504	0.540	3.881E-28	465	0.224	0.241	F1NUT2.pdb.gz
4	AFDB:F1P4H2	0.507	0.581	3.926E-27	434	0.198	0.228	F1P4H2.pdb.gz
5	AFDB:A0A0R4ILD5	0.459	0.511	1.320E-26	446	0.194	0.217	A0A0R4ILD5.pdb.gz
6	AFDB:Q9PTF9	0.505	0.580	3.015E-26	432	0.206	0.238	Q9PTF9.pdb.gz	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
7	AFDB:A8K571	0.502	0.578	3.759E-26	431	0.186	0.216	A8K571.pdb.gz	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
8	AFDB:Q98950	0.446	0.583	1.779E-24	373	0.212	0.284	Q98950.pdb.gz	Q98950_CHICK CVg1 protein OS=Gallus gallus OX=9031 GN=cVg1 PE=2 SV=1
9	AFDB:P27091	0.466	0.508	2.098E-24	455	0.190	0.209	P27091.pdb.gz	60A_DROME Protein 60A OS=Drosophila melanogaster OX=7227 GN=gbb PE=1 SV=1
10	AFDB:P22004	0.505	0.494	2.475E-24	513	0.232	0.226	P22004.pdb.gz	BMP6_HUMAN Bone morphogenetic protein 6 OS=Homo sapiens OX=9606 GN=BMP6 PE=1 SV=1
11	PDB:5vqfB	0.247	0.372	2.188E-15	320	0.148	0.231	5vqfB.pdb.gz
12	PDB:5hlyA	0.237	0.365	3.634E-14	299	0.130	0.217	5hlyA.pdb.gz
13	PDB:3rjrC	0.245	0.345	8.776E-14	343	0.158	0.230	3rjrC.pdb.gz
14	PDB:5ntuA	0.201	0.302	1.364E-13	308	0.130	0.211	5ntuA.pdb.gz
15	PDB:5ffoG	0.254	0.408	2.144E-12	297	0.134	0.226	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
16	PDB:6umxA	0.214	0.354	9.489E-12	279	0.110	0.197	6umxA.pdb.gz
17	PDB:5nxsA	0.208	0.323	2.291E-11	290	0.130	0.224	5nxsA.pdb.gz
18	PDB:7y1rB	0.235	0.361	3.762E-11	308	0.144	0.234	7y1rB.pdb.gz
19	PDB:5nxsB	0.164	0.284	1.225E-8	251	0.120	0.239	5nxsB.pdb.gz
20	PDB:6q2sA	0.130	0.524	5.998E-4	98	0.044	0.224	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0RAY4	0.0	892	495	0.878	0.889	M0RAY4_RAT Growth differentiation factor 5 OS=Rattus norvegicus OX=10116 GN=Gdf5 PE=3 SV=1
2	P43026	0.0	1021	501	0.998	0.998	GDF5_HUMAN Growth/differentiation factor 5 OS=Homo sapiens OX=9606 GN=GDF5 PE=1 SV=4
3	P43027	0.0	893	495	0.880	0.891	GDF5_MOUSE Growth/differentiation factor 5 OS=Mus musculus OX=10090 GN=Gdf5 PE=1 SV=2
4	P85857	5.58e-122	365	404	0.391	0.485	GDF6A_DANRE Growth/differentiation factor 6-A OS=Danio rerio OX=7955 GN=gdf6a PE=1 SV=1
5	P43028	5.31e-112	341	454	0.399	0.441	GDF6_MOUSE Growth/differentiation factor 6 OS=Mus musculus OX=10090 GN=Gdf6 PE=2 SV=2
6	Q6KF10	6.72e-112	340	455	0.389	0.429	GDF6_HUMAN Growth/differentiation factor 6 OS=Homo sapiens OX=9606 GN=GDF6 PE=1 SV=1
7	Q7Z4P5	1.06e-80	260	450	0.309	0.344	GDF7_HUMAN Growth/differentiation factor 7 OS=Homo sapiens OX=9606 GN=GDF7 PE=2 SV=2
8	P43029	5.04e-78	253	461	0.327	0.356	GDF7_MOUSE Growth/differentiation factor 7 OS=Mus musculus OX=10090 GN=Gdf7 PE=2 SV=2
9	O57574	4.54e-45	164	400	0.234	0.292	O57574_DANRE Bone morphogenetic protein 4 OS=Danio rerio OX=7955 GN=zBMP-4 PE=2 SV=1
10	Q90752	1.19e-44	164	405	0.226	0.279	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1
11	Q8UVQ2	6.68e-44	161	391	0.230	0.294	Q8UVQ2_DANRE Anti-dorsalizing morphogenetic protein OS=Danio rerio OX=7955 GN=wu:fe05b04 PE=2 SV=1
12	A5HMF9	6.69e-44	161	404	0.228	0.282	A5HMF9_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=3 SV=1
13	C8C060	1.04e-43	160	396	0.224	0.283	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
14	P12643	1.04e-43	160	396	0.224	0.283	BMP2_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=1 SV=1
15	P49001	1.44e-43	160	393	0.236	0.300	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
16	P12644	1.66e-43	160	408	0.226	0.277	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
17	A5HMF8	1.73e-43	160	404	0.228	0.282	A5HMF8_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=2 SV=1
18	Q7T288	2.53e-43	161	446	0.196	0.220	Q7T288_DANRE Bone morphogenetic protein 5 OS=Danio rerio OX=7955 GN=bmp5l PE=2 SV=1
19	P21274	3.08e-43	159	394	0.242	0.307	BMP2_MOUSE Bone morphogenetic protein 2 OS=Mus musculus OX=10090 GN=Bmp2 PE=1 SV=3
20	O93369	3.70e-42	157	411	0.234	0.285	O93369_DANRE Bone morphogenetic protein 2 OS=Danio rerio OX=7955 GN=BMP2b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	1.7e-06	39.4	TGF-beta propeptide
2	PF00019 TGF_beta	4.8e-30	115.8	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363492

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401907	0.999	Bone morphogenetic protein receptor type-1B
2	9606.ENSP00000361107	0.997	Bone morphogenetic protein receptor type-1A
3	9606.ENSP00000363708	0.992	Bone morphogenetic protein receptor type-2
4	9606.ENSP00000241416	0.975	Activin receptor type-2A
5	9606.ENSP00000318650	0.956	Gremlin-2
6	9606.ENSP00000328181	0.950	Noggin
7	9606.ENSP00000340361	0.945	Activin receptor type-2B
8	9606.ENSP00000308219	0.887	RGM domain family member B
9	9606.ENSP00000204604	0.864	Chordin
10	9606.ENSP00000386884	0.851	C-X-C chemokine receptor type 4
11	9606.ENSP00000452126	0.840	Repulsive guidance molecule A
12	9606.ENSP00000337014	0.822	Hemojuvelin
13	9606.ENSP00000478319	0.816	Gremlin-1
14	9606.ENSP00000417898	0.764	Glycodelin
15	9606.ENSP00000272164	0.740	Protein Wnt-9a
16	9606.ENSP00000387356	0.717	Aggrecan core protein
17	9606.ENSP00000245479	0.704	Transcription factor SOX-9
18	9606.ENSP00000364694	0.703	Asporin
19	9606.ENSP00000263640	0.695	Activin receptor type-1
20	9606.ENSP00000289749	0.689	Neuroblastoma suppressor of tumorigenicity 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0140677	0.986	molecular function activator activity
GO:0048018	0.984	receptor ligand activity
GO:0042802	0.981	identical protein binding
GO:0019955	0.866	cytokine binding
GO:0036122	0.784	BMP binding
GO:0008083	0.744	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0032502	0.995	developmental process
GO:0032501	0.994	multicellular organismal process
GO:0009987	0.993	cellular process
GO:0048856	0.993	anatomical structure development
GO:0048518	0.979	positive regulation of biological process
GO:0048583	0.975	regulation of response to stimulus
GO:0007275	0.975	multicellular organism development
GO:0048522	0.968	positive regulation of cellular process
GO:0048519	0.962	negative regulation of biological process
GO:0010646	0.955	regulation of cell communication
GO:0050793	0.946	regulation of developmental process
GO:0023051	0.946	regulation of signaling
GO:0061035	0.944	regulation of cartilage development
GO:0007165	0.939	signal transduction
GO:0007166	0.930	cell surface receptor signaling pathway
GO:0048731	0.919	system development
GO:0048523	0.918	negative regulation of cellular process
GO:0007178	0.918	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048513	0.900	animal organ development
GO:0009966	0.897	regulation of signal transduction
GO:0045595	0.880	regulation of cell differentiation
GO:0009888	0.877	tissue development
GO:0051240	0.866	positive regulation of multicellular organismal process
GO:0045597	0.860	positive regulation of cell differentiation
GO:0001501	0.853	skeletal system development
GO:0030154	0.846	cell differentiation
GO:0051093	0.780	negative regulation of developmental process
GO:0070848	0.760	response to growth factor
GO:0090092	0.759	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0023056	0.756	positive regulation of signaling
GO:0010647	0.756	positive regulation of cell communication
GO:0009653	0.705	anatomical structure morphogenesis
GO:0010941	0.698	regulation of cell death
GO:0071363	0.692	cellular response to growth factor stimulus
GO:0032330	0.683	regulation of chondrocyte differentiation
GO:0045664	0.669	regulation of neuron differentiation
GO:0019222	0.638	regulation of metabolic process
GO:0061448	0.637	connective tissue development
GO:0061036	0.629	positive regulation of cartilage development
GO:0051216	0.627	cartilage development
GO:0060255	0.620	regulation of macromolecule metabolic process
GO:0080090	0.585	regulation of primary metabolic process
GO:0042127	0.566	regulation of cell population proliferation
GO:0009967	0.565	positive regulation of signal transduction
GO:0035556	0.543	intracellular signal transduction
GO:0051171	0.530	regulation of nitrogen compound metabolic process
GO:0008152	0.505	metabolic process
GO:0031323	0.498	regulation of cellular metabolic process
GO:0071704	0.464	organic substance metabolic process
GO:0044238	0.455	primary metabolic process
GO:0010468	0.454	regulation of gene expression
GO:0006807	0.412	nitrogen compound metabolic process
GO:0043170	0.369	macromolecule metabolic process
GO:0010604	0.369	positive regulation of macromolecule metabolic process
GO:0051173	0.365	positive regulation of nitrogen compound metabolic process
GO:0031325	0.355	positive regulation of cellular metabolic process
GO:0090287	0.346	regulation of cellular response to growth factor stimulus
GO:0051252	0.322	regulation of RNA metabolic process
GO:0009889	0.317	regulation of biosynthetic process
GO:0001503	0.311	ossification
GO:0031326	0.305	regulation of cellular biosynthetic process
GO:1903506	0.303	regulation of nucleic acid-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0043227	0.745	membrane-bounded organelle
GO:0005622	0.594	intracellular anatomical structure
GO:0005615	0.493	extracellular space
GO:0071944	0.421	cell periphery
GO:0043231	0.387	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]