StarFunc result for job id P43116

User Input

>input (358 residues)
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43116	1.000	1.000	1.669E-49	358	1.000	1.000	P43116.pdb.gz	PE2R2_HUMAN Prostaglandin E2 receptor EP2 subtype OS=Homo sapiens OX=9606 GN=PTGER2 PE=1 SV=2
2	AFDB:Q9XT82	0.951	0.944	1.656E-42	361	0.880	0.873	Q9XT82.pdb.gz	PE2R2_CANLF Prostaglandin E2 receptor EP2 subtype OS=Canis lupus familiaris OX=9615 GN=PTGER2 PE=2 SV=1
3	AFDB:Q62053	0.926	0.916	8.983E-41	362	0.846	0.837	Q62053.pdb.gz	PE2R2_MOUSE Prostaglandin E2 receptor EP2 subtype OS=Mus musculus OX=10090 GN=Ptger2 PE=2 SV=1
4	PDB:7cx2R	0.690	0.915	1.063E-26	266	0.740	0.996	7cx2R.pdb.gz	Ligand recognition, unconventional activation, and G protein coupling of the prostaglandin E 2 receptor EP2 subtype.
5	AFDB:Q2MV23	0.882	0.859	1.935E-25	368	0.422	0.410	Q2MV23.pdb.gz
6	AFDB:P70263	0.802	0.804	4.852E-24	357	0.427	0.429	P70263.pdb.gz	PD2R_MOUSE Prostaglandin D2 receptor OS=Mus musculus OX=10090 GN=Ptgdr PE=2 SV=1
7	AFDB:E7FE45	0.786	0.774	1.652E-23	364	0.433	0.426	E7FE45.pdb.gz	E7FE45_DANRE Prostacyclin receptor OS=Danio rerio OX=7955 GN=ptgir PE=3 SV=1
8	AFDB:Q13258	0.756	0.754	2.098E-22	359	0.422	0.421	Q13258.pdb.gz	PD2R_HUMAN Prostaglandin D2 receptor OS=Homo sapiens OX=9606 GN=PTGDR PE=2 SV=2
9	AFDB:P43119	0.749	0.697	2.195E-22	386	0.422	0.391	P43119.pdb.gz	PI2R_HUMAN Prostacyclin receptor OS=Homo sapiens OX=9606 GN=PTGIR PE=1 SV=1
10	AFDB:Q1LUG8	0.795	0.833	3.156E-22	341	0.425	0.446	Q1LUG8.pdb.gz
11	AFDB:P43252	0.751	0.652	3.784E-22	415	0.425	0.366	P43252.pdb.gz	PI2R_MOUSE Prostacyclin receptor OS=Mus musculus OX=10090 GN=Ptgir PE=1 SV=1
12	PDB:6m9tA	0.697	0.568	1.455E-11	444	0.260	0.209	6m9tA.pdb.gz	Crystal structure of misoprostol bound to the labor inducer prostaglandin E2receptor.
13	PDB:6osaR	0.553	0.609	1.242E-9	321	0.190	0.212	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
14	PDB:4xesA	0.539	0.421	1.631E-9	471	0.198	0.151	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.
15	PDB:3aymA	0.588	0.600	6.660E-9	350	0.120	0.123	3aymA.pdb.gz	Crystallographic Analysis of the Primary Photochemical Reaction of Squid Rhodopsin
16	PDB:7w55R	0.522	0.603	1.377E-8	303	0.159	0.188	7w55R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
17	PDB:7wq3R	0.524	0.633	3.261E-8	289	0.137	0.170	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
18	PDB:5w0pC	0.610	0.275	3.412E-8	850	0.115	0.048	5w0pC.pdb.gz
19	PDB:7cmuR	0.555	0.708	5.133E-8	272	0.142	0.188	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
20	PDB:7x5hR	0.526	0.662	5.133E-8	274	0.145	0.190	7x5hR.pdb.gz	Structural insights into the ligand binding and G i coupling of serotonin receptor 5-HT 5A .

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43116	0.0	726	358	1.000	1.000	PE2R2_HUMAN Prostaglandin E2 receptor EP2 subtype OS=Homo sapiens OX=9606 GN=PTGER2 PE=1 SV=2
2	Q62053	0.0	595	362	0.872	0.862	PE2R2_MOUSE Prostaglandin E2 receptor EP2 subtype OS=Mus musculus OX=10090 GN=Ptger2 PE=2 SV=1
3	Q62928	0.0	580	357	0.838	0.840	PE2R2_RAT Prostaglandin E2 receptor EP2 subtype OS=Rattus norvegicus OX=10116 GN=Ptger2 PE=2 SV=1
4	Q9XT82	0.0	608	361	0.880	0.873	PE2R2_CANLF Prostaglandin E2 receptor EP2 subtype OS=Canis lupus familiaris OX=9615 GN=PTGER2 PE=2 SV=1
5	Q5RI92	7.99e-86	265	341	0.425	0.446	Q5RI92_DANRE Prostaglandin E receptor 2b (subtype EP2) OS=Danio rerio OX=7955 GN=si:ch211-13n20.1 PE=4 SV=1
6	E7FE45	9.76e-84	260	364	0.430	0.423	E7FE45_DANRE Prostacyclin receptor OS=Danio rerio OX=7955 GN=ptgir PE=3 SV=1
7	P43119	2.74e-79	249	386	0.422	0.391	PI2R_HUMAN Prostacyclin receptor OS=Homo sapiens OX=9606 GN=PTGIR PE=1 SV=1
8	P70263	1.11e-77	244	357	0.427	0.429	PD2R_MOUSE Prostaglandin D2 receptor OS=Mus musculus OX=10090 GN=Ptgdr PE=2 SV=1
9	P43252	5.33e-77	244	415	0.405	0.349	PI2R_MOUSE Prostacyclin receptor OS=Mus musculus OX=10090 GN=Ptgir PE=1 SV=1
10	Q6PFT8	3.05e-74	233	281	0.344	0.438	Q6PFT8_DANRE Prostaglandin E receptor 2 (Subtype EP2)-like OS=Danio rerio OX=7955 GN=ptger2l PE=2 SV=1
11	Q9R261	4.47e-70	225	357	0.419	0.420	PD2R_RAT Prostaglandin D2 receptor OS=Rattus norvegicus OX=10116 GN=Ptgdr PE=2 SV=1
12	Q13258	3.08e-65	212	359	0.419	0.418	PD2R_HUMAN Prostaglandin D2 receptor OS=Homo sapiens OX=9606 GN=PTGDR PE=2 SV=2
13	Q2N1D9	1.20e-53	183	403	0.344	0.305	Q2N1D9_DANRE Prostaglandin E2 receptor EP4 subtype OS=Danio rerio OX=7955 GN=ptger4 PE=2 SV=1
14	S6B1G5	3.19e-53	184	486	0.321	0.237	S6B1G5_DANRE Prostaglandin E receptor 4 (Subtype EP4) c OS=Danio rerio OX=7955 GN=si:ch211-234e14.2 PE=2 SV=1
15	P32240	2.63e-48	172	513	0.330	0.230	PE2R4_MOUSE Prostaglandin E2 receptor EP4 subtype OS=Mus musculus OX=10090 GN=Ptger4 PE=1 SV=1
16	A3QK20	3.07e-48	171	497	0.327	0.235	A3QK20_DANRE Prostaglandin E2 receptor EP4 subtype (Fragment) OS=Danio rerio OX=7955 GN=si:dkey-204l11.6 PE=3 SV=1
17	A0A0A7MA29	4.10e-48	171	472	0.324	0.246	A0A0A7MA29_SALSA Prostaglandin E2 receptor EP4 subtype OS=Salmo salar OX=8030 PE=2 SV=1
18	C0HB24	4.78e-47	167	472	0.316	0.239	C0HB24_SALSA Prostaglandin E2 receptor EP4 subtype OS=Salmo salar OX=8030 GN=PE2R4 PE=2 SV=1
19	P35408	1.94e-46	166	488	0.327	0.240	PE2R4_HUMAN Prostaglandin E2 receptor EP4 subtype OS=Homo sapiens OX=9606 GN=PTGER4 PE=1 SV=1
20	P43114	8.44e-46	165	488	0.316	0.232	PE2R4_RAT Prostaglandin E2 receptor EP4 subtype OS=Rattus norvegicus OX=10116 GN=Ptger4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.1e-23	95.4	7 transmembrane receptor (rhodopsin family)
2	PF10320 7TM_GPCR_Srsx	0.88	20.5	Serpentine type 7TM GPCR chemoreceptor Srsx
3	PF10328 7TM_GPCR_Srx	0.015	26.5	Serpentine type 7TM GPCR chemoreceptor Srx
4	PF02118 Srg	7.9	17.6	Srg family chemoreceptor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245457

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360141	0.933	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
2	9606.ENSP00000302846	0.854	Prostaglandin E2 receptor EP4 subtype
3	9606.ENSP00000403701	0.724	Beta-arrestin-2
4	9606.ENSP00000342385	0.716	Prostaglandin E synthase
5	9606.ENSP00000334448	0.685	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
6	9606.ENSP00000356438	0.678	Prostaglandin G/H synthase 2
7	9606.ENSP00000354612	0.673	Prostaglandin G/H synthase 1
8	9606.ENSP00000229264	0.656	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
9	9606.ENSP00000312999	0.654	Guanine nucleotide-binding protein G(i) subunit alpha-2
10	9606.ENSP00000232564	0.648	Guanine nucleotide-binding protein subunit beta-4
11	9606.ENSP00000261837	0.648	Guanine nucleotide-binding protein subunit beta-5
12	9606.ENSP00000305260	0.648	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
13	9606.ENSP00000481878	0.648	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
14	9606.ENSP00000343027	0.645	Guanine nucleotide-binding protein G(i) subunit alpha-1
15	9606.ENSP00000358867	0.645	Guanine nucleotide-binding protein G(k) subunit alpha
16	9606.ENSP00000281741	0.634	Thioredoxin domain containing 16
17	9606.ENSP00000371234	0.624	Cystin-1
18	9606.ENSP00000462647	0.620	Pituitary adenylate cyclase-activating polypeptide
19	9606.ENSP00000426022	0.614	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
20	9606.ENSP00000337065	0.609	C-X-C motif chemokine 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004957	1.000	prostaglandin E receptor activity
GO:0005515	0.635	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050896	0.992	response to stimulus
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0007186	0.979	G protein-coupled receptor signaling pathway
GO:0048518	0.539	positive regulation of biological process
GO:0019222	0.498	regulation of metabolic process
GO:0080090	0.451	regulation of primary metabolic process
GO:0048523	0.451	negative regulation of cellular process
GO:0060255	0.450	regulation of macromolecule metabolic process
GO:0031323	0.447	regulation of cellular metabolic process
GO:0048522	0.430	positive regulation of cellular process
GO:0032501	0.420	multicellular organismal process
GO:0008152	0.342	metabolic process
GO:0042221	0.332	response to chemical
GO:0065009	0.330	regulation of molecular function
GO:0071704	0.328	organic substance metabolic process
GO:0051171	0.327	regulation of nitrogen compound metabolic process
GO:0048583	0.313	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.596	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]