StarFunc result for job id P43146

User Input

>input (1447 residues)
MENSLRCVWVPKLAFVLFGASLFSAHLQVTGFQIKAFTALRFLSEPSDAVTMRGGNVLLD
CSAESDRGVPVIKWKKDGIHLALGMDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEAS
LGDSGSIISRTAKVAVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDL
TPIPGDSRVVVLPSGALQISRLQPGDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQL
YFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNV
TDDDSGMYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECTVSGKPVP
TVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSAQLIVPKP
AIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTT
QPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTS
PTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYSLRFLA
YNRYGPGVSTDDITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKI
RHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDL
DESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDL
STPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSEDT
TSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKP
RAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYF
RIQARNSKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPI
GQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQQRKKRATHSAGK
RKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGS
KSTSHSGQDTEEAGSSMSTLERSLAARRAPRAKLMIPMDAQSNNPAVVSAIPVPTLESAQ
YPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRSQSVSEGPTTQQPPMLPPSQPEH
SSSEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVK
TASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMASLEGLMKQLN
AITGSAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B5JKA2	0.199	0.265	0.000	1069	0.524	0.709	A0A0B5JKA2.pdb.gz
2	AFDB:A0A0G2KXQ3	0.197	0.227	0.000	1200	0.538	0.648	A0A0G2KXQ3.pdb.gz
3	AFDB:A0A0R4IP15	0.215	0.217	0.000	1428	0.490	0.496	A0A0R4IP15.pdb.gz	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
4	AFDB:P43146	1.000	1.000	0.000	1447	1.000	1.000	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
5	AFDB:P97798	0.262	0.254	0.000	1493	0.519	0.503	P97798.pdb.gz	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
6	AFDB:Q92859	0.346	0.343	0.000	1461	0.511	0.507	Q92859.pdb.gz	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
7	AFDB:F1R2D2	0.127	0.110	2.115E-64	1687	0.200	0.172	F1R2D2.pdb.gz
8	AFDB:A0A2R8QRK0	0.132	0.134	4.366E-64	1420	0.196	0.200	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
9	AFDB:O55005	0.127	0.112	9.168E-62	1651	0.201	0.176	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
10	AFDB:A0A0G2JZA1	0.126	0.121	2.978E-61	1512	0.220	0.210	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
11	PDB:5oj2B	0.108	0.187	5.348E-24	692	0.080	0.168	5oj2B.pdb.gz
12	PDB:1e07A	0.108	0.209	4.614E-20	642	0.088	0.199	1e07A.pdb.gz
13	PDB:5a42A	0.078	0.075	1.191E-14	1597	0.085	0.077	5a42A.pdb.gz
14	PDB:7q5zA	0.081	0.085	2.459E-14	1344	0.071	0.077	7q5zA.pdb.gz
15	PDB:7q1yA	0.115	0.119	1.148E-13	1374	0.064	0.067	7q1yA.pdb.gz
16	PDB:6pxvA	0.116	0.197	1.576E-13	823	0.046	0.081	6pxvA.pdb.gz
17	PDB:8dtlA	0.119	0.222	1.650E-13	741	0.044	0.085	8dtlA.pdb.gz
18	PDB:8eyyA	0.131	0.214	4.470E-13	775	0.041	0.077	8eyyA.pdb.gz
19	PDB:4lnvA	0.080	0.085	1.821E-12	1276	0.064	0.073	4lnvA.pdb.gz
20	PDB:6h03A	0.113	0.124	1.906E-12	1223	0.063	0.074	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IIB3	0.0	1383	1409	0.503	0.517	A0A0R4IIB3_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=3 SV=2
2	A0A0R4IP15	0.0	1398	1428	0.508	0.515	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
3	A1Z921	0.0	660	1375	0.287	0.302	A1Z921_DROME Frazzled, isoform B OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
4	P43146	0.0	2977	1447	1.000	1.000	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
5	P70211	0.0	2887	1447	0.965	0.965	DCC_MOUSE Netrin receptor DCC OS=Mus musculus OX=10090 GN=Dcc PE=1 SV=2
6	P97603	0.0	1372	1377	0.508	0.534	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
7	P97798	0.0	1382	1492	0.520	0.505	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
8	Q3S3D7	0.0	1323	1441	0.507	0.509	Q3S3D7_XENBO Neogenin variant 1 OS=Xenopus borealis OX=8354 PE=2 SV=1
9	Q49BB0	0.0	2078	1421	0.711	0.724	Q49BB0_DANRE Deleted in colorectal cancer OS=Danio rerio OX=7955 GN=zdcc PE=1 SV=1
10	Q59FP8	0.0	1101	1130	0.419	0.536	Q59FP8_HUMAN Neogenin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=1
11	Q63155	0.0	2878	1445	0.964	0.965	DCC_RAT Netrin receptor DCC OS=Rattus norvegicus OX=10116 GN=Dcc PE=1 SV=2
12	Q91562	0.0	2403	1427	0.814	0.826	Q91562_XENLA Deleted in colorectal carcinoma OS=Xenopus laevis OX=8355 GN=dcc.L PE=1 SV=1
13	Q92859	0.0	1377	1461	0.513	0.508	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
14	Q94537	0.0	662	1375	0.287	0.302	Q94537_DROME Frazzled OS=Drosophila melanogaster OX=7227 GN=fra PE=2 SV=1
15	G5EF96	8.20e-174	560	1415	0.261	0.267	UNC40_CAEEL Netrin receptor unc-40 OS=Caenorhabditis elegans OX=6239 GN=unc-40 PE=1 SV=1
16	A0A0B4LEX6	3.59e-135	456	1517	0.182	0.173	A0A0B4LEX6_DROME Frazzled, isoform C OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
17	Q94538	3.78e-135	456	1526	0.182	0.172	Q94538_DROME Frazzled OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
18	A1Z920	4.22e-135	456	1526	0.182	0.172	A1Z920_DROME FI24025p1 OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
19	Q2EY14	4.37e-80	290	1149	0.178	0.224	PRTGA_DANRE Protogenin A OS=Danio rerio OX=7955 GN=prtga PE=2 SV=1
20	Q2EY15	7.00e-76	278	1191	0.183	0.223	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	1e+02	14.1	Adenovirus E3 region protein CR1
2	PF08205 C2-set_2	3.7e-07	41.4	CD80-like C2-set immunoglobulin domain
3	PF06365 CD34_antigen	1.8e+02	13.2	CD34/Podocalyxin family
4	PF16389 DUF4998	6e+02	11.4	Domain of unknown function
5	PF14575 EphA2_TM	39	16.4	Ephrin type-A receptor 2 transmembrane domain
6	PF14851 FAM176	38	15.5	FAM176 family
7	PF00041 fn3	8.3e-74	255.3	Fibronectin type III domain
8	PF02480 Herpes_gE	5.6e+02	11.4	Alphaherpesvirus glycoprotein E
9	PF07679 I-set	7.8e-57	200.7	Immunoglobulin I-set domain
10	PF00047 ig	9.1e-35	130.0	Immunoglobulin domain
11	PF13895 Ig_2	1.1e-32	123.5	Immunoglobulin domain
12	PF13927 Ig_3	3.9e-52	186.0	Immunoglobulin domain
13	PF16680 Ig_4	0.0035	29.2	T-cell surface glycoprotein CD3 delta chain
14	PF16681 Ig_5	0.00023	32.8	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
15	PF18452 Ig_6	92	14.3	Immunoglobulin domain
16	PF09294 Interfer-bind	0.00024	32.7	Interferon-alpha/beta receptor, fibronectin type III
17	PF08391 Ly49	2e+02	13.8	Ly49-like protein, N-terminal region
18	PF10179 NDNF	32	16.1	Neuron-derived neurotrophic factor, first Fn(III) domain
19	PF06583 Neogenin_C	1.2e-108	375.2	Neogenin C-terminus
20	PF08374 Protocadherin	3.2	19.2	Protocadherin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000173229	0.999	Netrin-1
2	9606.ENSP00000341189	0.985	Focal adhesion kinase 1
3	9606.ENSP00000406022	0.980	Netrin receptor UNC5C
4	9606.ENSP00000421280	0.980	Unconventional myosin-X
5	9606.ENSP00000332737	0.979	Netrin receptor UNC5A
6	9606.ENSP00000334329	0.979	Netrin receptor UNC5B
7	9606.ENSP00000298355	0.975	E3 ubiquitin-protein ligase TRIM9
8	9606.ENSP00000280333	0.959	Dedicator of cytokinesis protein 1
9	9606.ENSP00000339299	0.951	Triple functional domain protein
10	9606.ENSP00000346671	0.948	Tyrosine-protein kinase Fyn
11	9606.ENSP00000383118	0.945	Cell division control protein 42 homolog
12	9606.ENSP00000262948	0.942	Dual specificity mitogen-activated protein kinase kinase 2
13	9606.ENSP00000316809	0.940	Phosphatidylinositol transfer protein alpha isoform
14	9606.ENSP00000302486	0.939	Dual specificity mitogen-activated protein kinase kinase 1
15	9606.ENSP00000330237	0.938	Caspase-9
16	9606.ENSP00000362680	0.936	Proto-oncogene tyrosine-protein kinase Src
17	9606.ENSP00000417273	0.935	Cytoplasmic protein NCK1
18	9606.ENSP00000311032	0.932	Caspase-3
19	9606.ENSP00000385143	0.931	Netrin receptor UNC5D
20	9606.ENSP00000391669	0.929	Breast cancer anti-estrogen resistance protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.987	signaling receptor activity
GO:0004888	0.980	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0048731	0.985	system development
GO:0007399	0.981	nervous system development
GO:0016043	0.945	cellular component organization
GO:0009653	0.943	anatomical structure morphogenesis
GO:0040011	0.932	locomotion
GO:0042221	0.903	response to chemical
GO:0048869	0.896	cellular developmental process
GO:0030154	0.893	cell differentiation
GO:0000902	0.875	cell morphogenesis
GO:0048468	0.859	cell development
GO:0032990	0.830	cell part morphogenesis
GO:0051128	0.822	regulation of cellular component organization
GO:0120039	0.808	plasma membrane bounded cell projection morphogenesis
GO:0048812	0.796	neuron projection morphogenesis
GO:0000904	0.718	cell morphogenesis involved in differentiation
GO:0048519	0.676	negative regulation of biological process
GO:0048523	0.648	negative regulation of cellular process
GO:0048583	0.615	regulation of response to stimulus
GO:0007409	0.615	axonogenesis
GO:0048518	0.596	positive regulation of biological process
GO:0009605	0.559	response to external stimulus
GO:0048522	0.532	positive regulation of cellular process
GO:0023051	0.529	regulation of signaling
GO:0010646	0.521	regulation of cell communication
GO:0006935	0.482	chemotaxis
GO:0051716	0.475	cellular response to stimulus
GO:0051239	0.425	regulation of multicellular organismal process
GO:0048513	0.388	animal organ development
GO:0097485	0.345	neuron projection guidance
GO:0009966	0.341	regulation of signal transduction
GO:0007411	0.336	axon guidance
GO:0065008	0.327	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.995	intracellular anatomical structure
GO:0005829	0.988	cytosol
GO:0043226	0.946	organelle
GO:0043227	0.899	membrane-bounded organelle
GO:0043229	0.877	intracellular organelle
GO:0043231	0.835	intracellular membrane-bounded organelle
GO:0005634	0.701	nucleus
GO:0012505	0.635	endomembrane system
GO:0070013	0.626	intracellular organelle lumen
GO:0120025	0.619	plasma membrane bounded cell projection
GO:0031981	0.608	nuclear lumen
GO:0043005	0.504	neuron projection
GO:0005654	0.442	nucleoplasm
GO:0030054	0.357	cell junction
GO:0030424	0.305	axon
GO:0032991	0.302	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]