StarFunc result for job id P43155

User Input

>input (626 residues)
MLAFAARTVVKPLGFLKPFSLMKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSE
EEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSP
GVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSC
RVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSS
LQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVY
RSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIE
YTKKPELVRSPLVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKD
FPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVK
AMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMD
TSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNA
ARLAHYLEKALLDMRALLQSHPRAKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2h3pA	0.949	0.992	0.000	599	0.867	0.907	2h3pA.pdb.gz	Crystal structures of murine carnitine acetyltransferase in ternary complexes with its substrates
2	AFDB:P43155	1.000	1.000	0.000	626	1.000	1.000	P43155.pdb.gz	CACP_HUMAN Carnitine O-acetyltransferase OS=Homo sapiens OX=9606 GN=CRAT PE=1 SV=5
3	AFDB:B2ZGJ1	0.911	0.895	2.097E-72	637	0.412	0.405	B2ZGJ1.pdb.gz	CLAT_DANRE Choline O-acetyltransferase OS=Danio rerio OX=7955 GN=chat PE=2 SV=1
4	AFDB:Q03059	0.913	0.892	1.712E-71	641	0.415	0.406	Q03059.pdb.gz	CLAT_MOUSE Choline O-acetyltransferase OS=Mus musculus OX=10090 GN=Chat PE=2 SV=2
5	PDB:1q6xA	0.903	0.941	3.637E-70	600	0.412	0.430	1q6xA.pdb.gz
6	AFDB:P28329	0.916	0.769	3.787E-70	748	0.419	0.350	P28329.pdb.gz	CLAT_HUMAN Choline O-acetyltransferase OS=Homo sapiens OX=9606 GN=CHAT PE=1 SV=4
7	AFDB:F1P393	0.907	0.888	8.771E-70	640	0.399	0.391	F1P393.pdb.gz	F1P393_CHICK Choline O-acetyltransferase OS=Gallus gallus OX=9031 GN=CHAT PE=3 SV=1
8	AFDB:Q9VI16	0.915	0.866	4.352E-65	662	0.351	0.332	Q9VI16.pdb.gz	Q9VI16_DROME Carnitine O-Acetyl-Transferase, isoform A OS=Drosophila melanogaster OX=7227 GN=CRAT PE=1 SV=2
9	AFDB:P07668	0.892	0.776	1.135E-62	721	0.375	0.326	P07668.pdb.gz	CLAT_DROME Choline O-acetyltransferase OS=Drosophila melanogaster OX=7227 GN=ChAT PE=1 SV=3
10	AFDB:C8V1G3	0.880	0.856	9.453E-59	644	0.353	0.343	C8V1G3.pdb.gz	C8V1G3_EMENI Choline/carnitine acyltransferase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06279 PE=3 SV=1
11	AFDB:P11466	0.876	0.895	1.516E-58	612	0.329	0.337	P11466.pdb.gz	OCTC_RAT Peroxisomal carnitine O-octanoyltransferase OS=Rattus norvegicus OX=10116 GN=Crot PE=1 SV=3
12	PDB:1xl8B	0.870	0.906	7.808E-58	600	0.316	0.330	1xl8B.pdb.gz	Crystal structure of mouse carnitine octanoyltransferase and molecular determinants of substrate selectivity.
13	AFDB:Q9UKG9	0.878	0.897	9.518E-58	612	0.313	0.320	Q9UKG9.pdb.gz	OCTC_HUMAN Peroxisomal carnitine O-octanoyltransferase OS=Homo sapiens OX=9606 GN=CROT PE=1 SV=2
14	PDB:4eywB	0.862	0.851	2.324E-51	634	0.289	0.285	4eywB.pdb.gz	Isothermal titration calorimetry with micelles: Thermodynamics of inhibitor binding to carnitine palmitoyltransferase 2 membrane protein.
15	PDB:1q9jB	0.244	0.359	1.120E-4	399	0.061	0.095	1q9jB.pdb.gz
16	PDB:6lpwB	0.220	0.291	1.120E-4	436	0.062	0.089	6lpwB.pdb.gz	Structural and Biochemical Insights Into Two BAHD Acyltransferases ( At SHT and At SDT) Involved in Phenolamide Biosynthesis.
17	PDB:1l5aA	0.244	0.333	1.618E-4	424	0.059	0.087	1l5aA.pdb.gz
18	PDB:5kjtA	0.227	0.304	4.162E-4	431	0.067	0.097	5kjtA.pdb.gz	Dynamic Conformational States Dictate Selectivity toward the Native Substrate in a Substrate-Permissive Acyltransferase.
19	PDB:2xr7A	0.226	0.292	8.234E-4	452	0.062	0.086	2xr7A.pdb.gz	Structural Basis for Modification of Flavonol and Naphthol Glucoconjugates by Nicotiana Tabacum Malonyltransferase (Ntmat1).
20	PDB:6wcsA	0.226	0.302	9.145E-4	438	0.051	0.073	6wcsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43155	0.0	1311	626	1.000	1.000	CACP_HUMAN Carnitine O-acetyltransferase OS=Homo sapiens OX=9606 GN=CRAT PE=1 SV=5
2	P47934	0.0	1214	626	0.909	0.909	CACP_MOUSE Carnitine O-acetyltransferase OS=Mus musculus OX=10090 GN=Crat PE=1 SV=3
3	Q704S8	0.0	1207	626	0.906	0.906	CACP_RAT Carnitine O-acetyltransferase OS=Rattus norvegicus OX=10116 GN=Crat PE=1 SV=1
4	Q03059	3.22e-170	501	641	0.417	0.407	CLAT_MOUSE Choline O-acetyltransferase OS=Mus musculus OX=10090 GN=Chat PE=2 SV=2
5	P32738	8.28e-170	500	640	0.420	0.411	CLAT_RAT Choline O-acetyltransferase OS=Rattus norvegicus OX=10116 GN=Chat PE=1 SV=2
6	B2ZGJ1	1.50e-167	494	637	0.411	0.403	CLAT_DANRE Choline O-acetyltransferase OS=Danio rerio OX=7955 GN=chat PE=2 SV=1
7	F1P393	1.15e-166	492	640	0.407	0.398	F1P393_CHICK Choline O-acetyltransferase OS=Gallus gallus OX=9031 GN=CHAT PE=3 SV=1
8	P28329	1.81e-165	493	748	0.417	0.349	CLAT_HUMAN Choline O-acetyltransferase OS=Homo sapiens OX=9606 GN=CHAT PE=1 SV=4
9	Q90YJ9	7.49e-165	487	640	0.404	0.395	CLAT_CHICK Choline O-acetyltransferase OS=Gallus gallus OX=9031 GN=CHAT PE=2 SV=1
10	A0A126GUQ4	2.68e-141	427	638	0.347	0.340	A0A126GUQ4_DROME Carnitine O-Acetyl-Transferase, isoform E OS=Drosophila melanogaster OX=7227 GN=CRAT PE=1 SV=1
11	Q9VI16	3.23e-141	427	662	0.347	0.328	Q9VI16_DROME Carnitine O-Acetyl-Transferase, isoform A OS=Drosophila melanogaster OX=7227 GN=CRAT PE=1 SV=2
12	Q0KIA8	4.11e-141	427	657	0.347	0.330	Q0KIA8_DROME Carnitine O-Acetyl-Transferase, isoform B OS=Drosophila melanogaster OX=7227 GN=CRAT PE=1 SV=1
13	P07668	1.29e-128	397	721	0.366	0.318	CLAT_DROME Choline O-acetyltransferase OS=Drosophila melanogaster OX=7227 GN=ChAT PE=1 SV=3
14	C8V1G3	1.28e-112	353	644	0.347	0.337	C8V1G3_EMENI Choline/carnitine acyltransferase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06279 PE=3 SV=1
15	Q9DC50	1.47e-98	315	612	0.332	0.340	OCTC_MOUSE Peroxisomal carnitine O-octanoyltransferase OS=Mus musculus OX=10090 GN=Crot PE=1 SV=1
16	P11466	2.80e-97	312	612	0.337	0.345	OCTC_RAT Peroxisomal carnitine O-octanoyltransferase OS=Rattus norvegicus OX=10116 GN=Crot PE=1 SV=3
17	Q5AMQ5	1.51e-95	308	632	0.321	0.318	Q5AMQ5_CANAL Carnitine O-acetyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAT2 PE=3 SV=1
18	Q9UKG9	8.45e-95	305	612	0.326	0.333	OCTC_HUMAN Peroxisomal carnitine O-octanoyltransferase OS=Homo sapiens OX=9606 GN=CROT PE=1 SV=2
19	Q1MTA9	1.10e-89	296	773	0.324	0.263	Q1MTA9_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1a PE=1 SV=2
20	Q7JQH9	1.43e-89	296	780	0.302	0.242	Q7JQH9_DROME carnitine O-palmitoyltransferase OS=Drosophila melanogaster OX=7227 GN=whd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00755 Carn_acyltransf	2.7e-192	652.0	Choline/Carnitine o-acyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315013

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420914	0.992	Peroxisomal multifunctional enzyme type 2
2	9606.ENSP00000293217	0.972	Peroxisomal acyl-coenzyme A oxidase 1
3	9606.ENSP00000221418	0.969	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
4	9606.ENSP00000231887	0.968	Peroxisomal bifunctional enzyme
5	9606.ENSP00000369461	0.968	Enoyl-CoA delta isomerase 2, mitochondrial
6	9606.ENSP00000326305	0.966	Mitochondrial carnitine/acylcarnitine carrier protein
7	9606.ENSP00000219481	0.961	Peroxisomal 2,4-dienoyl-CoA reductase
8	9606.ENSP00000360569	0.959	Non-specific lipid-transfer protein
9	9606.ENSP00000307697	0.958	Peroxisomal acyl-coenzyme A oxidase 2
10	9606.ENSP00000323811	0.946	2-hydroxyacyl-CoA lyase 1
11	9606.ENSP00000217455	0.945	Acyl-coenzyme A thioesterase 8
12	9606.ENSP00000326219	0.942	Dehydrogenase/reductase SDR family member 4
13	9606.ENSP00000241052	0.939	Catalase
14	9606.ENSP00000262430	0.939	Malonyl-CoA decarboxylase, mitochondrial
15	9606.ENSP00000348775	0.939	Peroxisomal acyl-coenzyme A oxidase 3
16	9606.ENSP00000363614	0.936	Hydroxymethylglutaryl-CoA lyase, mitochondrial
17	9606.ENSP00000302620	0.935	Alanine-glyoxylate aminotransferase
18	9606.ENSP00000355607	0.933	Glyceronephosphate O-acyltransferase
19	9606.ENSP00000323071	0.932	Acyl-coenzyme A thioesterase 4
20	9606.ENSP00000238651	0.930	Acyl-coenzyme A thioesterase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016406	1.000	carnitine O-acyltransferase activity
GO:0016413	1.000	O-acetyltransferase activity
GO:0005488	0.912	binding
GO:0005515	0.896	protein binding
GO:0016491	0.749	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006631	0.996	fatty acid metabolic process
GO:0006807	0.598	nitrogen compound metabolic process
GO:0046395	0.586	carboxylic acid catabolic process
GO:0009062	0.553	fatty acid catabolic process
GO:0030258	0.525	lipid modification
GO:0006635	0.483	fatty acid beta-oxidation
GO:1901564	0.445	organonitrogen compound metabolic process
GO:0034641	0.324	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005829	0.948	cytosol
GO:0070013	0.930	intracellular organelle lumen
GO:0042579	0.887	microbody
GO:0005777	0.883	peroxisome
GO:0031907	0.595	microbody lumen
GO:0016020	0.567	membrane
GO:0005782	0.467	peroxisomal matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
EC:1.-.-.-	0.749	Oxidoreductases.

[back to server]