StarFunc result for job id P43243

User Input

>input (847 residues)
MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTARLASLMNLGM
SSSLNQQGAHSALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGDADQASNILASFGLSAR
DLDELSRYPEDKITPENLPQILLQLKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEE
KRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDDRLRDGERCRDDSFFGETS
HNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIEDFHGLLPKGYPHLCSICDLPV
HSNKEWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGDPFMLQQSTNPAPGILGPPP
PSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVE
PFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKP
EGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEME
TREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRKRSYSPD
GKESPSDKKSKTDGSQKTESSTEGKEQEEKSGEDGEKDTKDDQTEQEPNMLLESEDELLV
DEEEAAALLESGSSVGDETDLANLGDVASDGKKEPSDKAVKKDGSASAAAKKKLKKVDKI
EELDQENEAALENGIKNEENTEPGAESSENADDPNKDTSENADGQSDENKDDYTIPDEYR
IGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEE
RRQKKET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43243	1.000	1.000	0.000	847	1.000	1.000	P43243.pdb.gz	MATR3_HUMAN Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2
2	AFDB:E7ERJ7	0.088	0.120	1.116E-7	604	0.064	0.089	E7ERJ7.pdb.gz	E7ERJ7_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1
3	AFDB:P08965	0.091	0.102	1.843E-7	750	0.098	0.111	P08965.pdb.gz	MEI2_SCHPO Meiosis protein mei2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mei2 PE=1 SV=1
4	PDB:5vsuA	0.102	0.181	9.263E-7	387	0.035	0.078	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
5	PDB:6ff7X	0.091	0.412	1.157E-6	171	0.037	0.181	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
6	PDB:7oqcF	0.096	0.283	1.157E-6	267	0.034	0.109	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
7	PDB:6y5qq	0.090	0.375	1.910E-6	178	0.033	0.157	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
8	PDB:7evoD	0.090	0.331	2.019E-6	200	0.034	0.145	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
9	PDB:5lsbA	0.084	0.370	3.725E-6	176	0.040	0.193	5lsbA.pdb.gz
10	PDB:6y53o	0.081	0.396	1.073E-5	160	0.037	0.194	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
11	AFDB:Q9C5D3	0.076	0.167	1.870E-5	355	0.041	0.099	Q9C5D3.pdb.gz	HIP7_ARATH Heavy metal-associated isoprenylated plant protein 7 OS=Arabidopsis thaliana OX=3702 GN=HIPP07 PE=1 SV=1
12	PDB:3lqvB	0.086	0.596	1.468E-4	115	0.020	0.148	3lqvB.pdb.gz	Branch Recognition by SF3b14
13	PDB:7dvqY	0.098	0.507	1.552E-4	140	0.026	0.157	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:6exnY	0.089	0.758	2.049E-4	87	0.025	0.241	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
15	AFDB:O95104	0.085	0.063	2.705E-4	1147	0.102	0.075	O95104.pdb.gz	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
16	AFDB:F1LV37	0.094	0.051	2.963E-3	1818	0.109	0.051	F1LV37.pdb.gz	F1LV37_RAT Trinucleotide repeat containing adaptor 6B OS=Rattus norvegicus OX=10116 GN=Tnrc6b PE=1 SV=3
17	AFDB:Q9P2N5	0.087	0.071	3.501E-3	1060	0.122	0.097	Q9P2N5.pdb.gz	RBM27_HUMAN RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2
18	AFDB:Q9Y467	0.075	0.066	5.778E-3	1007	0.166	0.140	Q9Y467.pdb.gz	SALL2_HUMAN Sal-like protein 2 OS=Homo sapiens OX=9606 GN=SALL2 PE=1 SV=4
19	AFDB:B2RRE7	0.058	0.047	1.332E-2	1107	0.143	0.109	B2RRE7.pdb.gz	OTUD4_MOUSE OTU domain-containing protein 4 OS=Mus musculus OX=10090 GN=Otud4 PE=1 SV=1
20	AFDB:Q9UPQ9	0.095	0.048	1.966E-2	1833	0.116	0.053	Q9UPQ9.pdb.gz	TNR6B_HUMAN Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43243	0.0	1753	847	1.000	1.000	MATR3_HUMAN Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2
2	P43244	0.0	1711	845	0.974	0.976	MATR3_RAT Matrin-3 OS=Rattus norvegicus OX=10116 GN=Matr3 PE=1 SV=2
3	Q8K310	0.0	1722	846	0.983	0.985	MATR3_MOUSE Matrin-3 OS=Mus musculus OX=10090 GN=Matr3 PE=1 SV=1
4	P0DW16	1.34e-23	110	1223	0.081	0.056	RBM20_PIG RNA-binding protein 20 OS=Sus scrofa OX=9823 GN=RBM20 PE=1 SV=1
5	E9PT37	1.93e-21	102	1207	0.079	0.056	RBM20_RAT RNA-binding protein 20 OS=Rattus norvegicus OX=10116 GN=Rbm20 PE=1 SV=1
6	Q3UQS8	3.57e-21	102	1199	0.078	0.055	RBM20_MOUSE RNA-binding protein 20 OS=Mus musculus OX=10090 GN=Rbm20 PE=1 SV=3
7	Q5T481	4.91e-21	101	1227	0.078	0.054	RBM20_HUMAN RNA-binding protein 20 OS=Homo sapiens OX=9606 GN=RBM20 PE=1 SV=4
8	Q14966	3.86e-10	66.6	1978	0.028	0.012	ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2
9	Q80XZ1	4.47e-09	62.4	588	0.041	0.060	Q80XZ1_RAT Polypyrimidine tract-binding protein OS=Rattus norvegicus OX=10116 GN=Smptb PE=1 SV=1
10	Q00438	7.62e-08	58.5	556	0.039	0.059	PTBP1_RAT Polypyrimidine tract-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ptbp1 PE=1 SV=2
11	P17225	7.74e-08	58.2	555	0.039	0.059	PTBP1_MOUSE Polypyrimidine tract-binding protein 1 OS=Mus musculus OX=10090 GN=Ptbp1 PE=1 SV=3
12	P26599	3.78e-07	56.2	557	0.035	0.054	PTBP1_HUMAN Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=2
13	F5H2X7	5.10e-07	56.2	954	0.022	0.020	F5H2X7_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=2
14	Q5SYW2	5.35e-07	55.8	870	0.022	0.022	Q5SYW2_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
15	Q9BTG3	5.42e-07	55.8	837	0.022	0.023	Q9BTG3_HUMAN CIZ1 protein OS=Homo sapiens OX=9606 PE=1 SV=1
16	Q9ULV3	5.55e-07	55.8	898	0.022	0.021	CIZ1_HUMAN Cip1-interacting zinc finger protein OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=2
17	H0Y5D5	5.66e-07	55.8	820	0.022	0.023	H0Y5D5_HUMAN CDKN1A interacting zinc finger protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
18	A0A494C0L7	5.91e-07	55.8	820	0.022	0.023	A0A494C0L7_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
19	Q9CUW6	3.70e-06	50.8	206	0.022	0.092	Q9CUW6_MOUSE Matrin-type domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
20	Q8T0H5	3.92e-06	52.8	571	0.034	0.051	Q8T0H5_DROME LD03185p OS=Drosophila melanogaster OX=7227 GN=heph PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	4.6e-05	34.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF13893 RRM_5	0.016	26.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF04615 Utp14	78	13.3	Utp14 protein
4	PF12171 zf-C2H2_jaz	41	15.8	Zinc-finger double-stranded RNA-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354346

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349748	0.998	Splicing factor, proline- and glutamine-rich
2	9606.ENSP00000276079	0.997	Non-POU domain-containing octamer-binding protein
3	9606.ENSP00000341826	0.996	Heterogeneous nuclear ribonucleoprotein A1
4	9606.ENSP00000240185	0.994	TAR DNA-binding protein 43
5	9606.ENSP00000365439	0.992	Heterogeneous nuclear ribonucleoprotein K
6	9606.ENSP00000349168	0.991	Heterogeneous nuclear ribonucleoprotein H
7	9606.ENSP00000346694	0.989	Heterogeneous nuclear ribonucleoproteins A2/B1
8	9606.ENSP00000283179	0.986	Heterogeneous nuclear ribonucleoprotein U
9	9606.ENSP00000363745	0.985	Heterogeneous nuclear ribonucleoprotein R
10	9606.ENSP00000451291	0.985	Heterogeneous nuclear ribonucleoproteins C1/C2
11	9606.ENSP00000325376	0.983	Heterogeneous nuclear ribonucleoprotein M
12	9606.ENSP00000349428	0.983	Polypyrimidine tract-binding protein 1
13	9606.ENSP00000221419	0.982	Heterogeneous nuclear ribonucleoprotein L
14	9606.ENSP00000385269	0.981	ELAV-like protein 1
15	9606.ENSP00000311747	0.977	RNA-binding protein 14
16	9606.ENSP00000362820	0.977	Serine/arginine-rich splicing factor 3
17	9606.ENSP00000474096	0.977	TATA-binding protein-associated factor 2N
18	9606.ENSP00000400433	0.976	Heterogeneous nuclear ribonucleoprotein F
19	9606.ENSP00000316042	0.974	Heterogeneous nuclear ribonucleoprotein A0
20	9606.ENSP00000258962	0.973	Serine/arginine-rich splicing factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0061980	0.988	regulatory RNA binding
GO:0042802	0.955	identical protein binding
GO:0035198	0.935	miRNA binding
GO:0005198	0.930	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.983	regulation of biological process
GO:0048518	0.965	positive regulation of biological process
GO:0060255	0.942	regulation of macromolecule metabolic process
GO:0010468	0.911	regulation of gene expression
GO:0048583	0.856	regulation of response to stimulus
GO:0009987	0.807	cellular process
GO:0080134	0.745	regulation of response to stress
GO:0050794	0.744	regulation of cellular process
GO:0048584	0.736	positive regulation of response to stimulus
GO:0071704	0.641	organic substance metabolic process
GO:0002833	0.626	positive regulation of response to biotic stimulus
GO:0002253	0.616	activation of immune response
GO:0031347	0.606	regulation of defense response
GO:0044238	0.595	primary metabolic process
GO:0045089	0.582	positive regulation of innate immune response
GO:0043170	0.580	macromolecule metabolic process
GO:0006807	0.574	nitrogen compound metabolic process
GO:0044237	0.554	cellular metabolic process
GO:0051171	0.499	regulation of nitrogen compound metabolic process
GO:0080090	0.469	regulation of primary metabolic process
GO:0031323	0.410	regulation of cellular metabolic process
GO:0090304	0.410	nucleic acid metabolic process
GO:0010467	0.375	gene expression
GO:0010608	0.344	post-transcriptional regulation of gene expression
GO:0032502	0.341	developmental process
GO:0048522	0.330	positive regulation of cellular process
GO:0032501	0.326	multicellular organismal process
GO:0016070	0.326	RNA metabolic process
GO:0002218	0.326	activation of innate immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031981	0.985	nuclear lumen
GO:0005654	0.965	nucleoplasm
GO:0005737	0.962	cytoplasm
GO:0012505	0.536	endomembrane system
GO:0043232	0.534	intracellular non-membrane-bounded organelle
GO:0016020	0.518	membrane
GO:0005829	0.467	cytosol
GO:0032991	0.384	protein-containing complex
GO:0031090	0.367	organelle membrane
GO:0005635	0.365	nuclear envelope
GO:0005637	0.358	nuclear inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]