StarFunc result for job id P43250

User Input

>input (576 residues)
MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQ
PIGRLLFREFCATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPE
VPRQLVTNCTQRLEQGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLE
DLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNE
RYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLC
SQLLCKDPAERLGCRGGSAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDI
EQFSTVKGVELEPTDQDFYQKFATGSVPIPWQNEMVETECFQELNVFGLDGSVPPDLDWK
GQPPAPPKKGLLQRLFSRQDCCGNCSDSEEELPTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70293	0.962	0.962	1.102E-88	576	0.967	0.967	O70293.pdb.gz	GRK6_MOUSE G protein-coupled receptor kinase 6 OS=Mus musculus OX=10090 GN=Grk6 PE=1 SV=1
2	AFDB:Q08CJ6	0.952	0.957	3.698E-77	573	0.712	0.716	Q08CJ6.pdb.gz	Q08CJ6_DANRE G protein-coupled receptor kinase OS=Danio rerio OX=7955 GN=zgc:153020 PE=1 SV=1
3	AFDB:P34947	0.960	0.937	7.317E-76	590	0.703	0.686	P34947.pdb.gz	GRK5_HUMAN G protein-coupled receptor kinase 5 OS=Homo sapiens OX=9606 GN=GRK5 PE=1 SV=1
4	PDB:3nynA	0.873	0.907	7.847E-76	554	0.958	0.996	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
5	AFDB:F1R6F6	0.948	0.949	2.460E-75	575	0.686	0.687	F1R6F6.pdb.gz	F1R6F6_DANRE G protein-coupled receptor kinase OS=Danio rerio OX=7955 GN=grk5l PE=3 SV=1
6	AFDB:A8K8M5	0.912	0.909	1.484E-70	578	0.653	0.651	A8K8M5.pdb.gz	A8K8M5_HUMAN G protein-coupled receptor kinase OS=Homo sapiens OX=9606 PE=2 SV=1
7	AFDB:P70507	0.911	0.913	6.917E-70	575	0.637	0.638	P70507.pdb.gz	GRK4_RAT G protein-coupled receptor kinase 4 OS=Rattus norvegicus OX=10116 GN=Grk4 PE=1 SV=1
8	PDB:6pjxA	0.857	0.905	3.150E-69	543	0.674	0.715	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
9	AFDB:F1RAR9	0.897	0.879	7.615E-62	588	0.531	0.520	F1RAR9.pdb.gz	F1RAR9_DANRE G protein-coupled receptor kinase OS=Danio rerio OX=7955 GN=si:dkey-171l20.1 PE=3 SV=1
10	PDB:4yhjA	0.845	0.970	6.662E-61	501	0.599	0.689	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
11	AFDB:P32866	0.928	0.750	4.013E-60	714	0.606	0.489	P32866.pdb.gz	GPRK2_DROME G protein-coupled receptor kinase 2 OS=Drosophila melanogaster OX=7227 GN=Gprk2 PE=1 SV=3
12	AFDB:Q1XHM0	0.910	0.931	7.673E-57	563	0.457	0.467	Q1XHM0.pdb.gz	Q1XHM0_DANRE G protein-coupled receptor kinase OS=Danio rerio OX=7955 GN=grk1 PE=1 SV=1
13	AFDB:Q63651	0.908	0.926	3.926E-56	564	0.457	0.466	Q63651.pdb.gz	GRK1_RAT Rhodopsin kinase GRK1 OS=Rattus norvegicus OX=10116 GN=Grk1 PE=1 SV=1
14	PDB:3c4wB	0.832	0.921	6.849E-49	519	0.420	0.466	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
15	PDB:3c51B	0.766	0.952	1.893E-42	461	0.401	0.501	3c51B.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
16	PDB:4mk0A	0.718	0.660	4.908E-35	631	0.333	0.304	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	PDB:3pvuA	0.707	0.670	7.007E-34	609	0.326	0.309	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
18	PDB:3uzsA	0.692	0.657	7.397E-29	609	0.304	0.287	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
19	PDB:3pfqA	0.479	0.526	1.619E-22	523	0.207	0.228	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
20	PDB:6byrA	0.482	0.675	1.696E-22	405	0.196	0.279	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K8M5	0.0	761	578	0.651	0.649	A8K8M5_HUMAN G protein-coupled receptor kinase OS=Homo sapiens OX=9606 PE=2 SV=1
2	F1R6F6	0.0	790	575	0.691	0.692	F1R6F6_DANRE G protein-coupled receptor kinase OS=Danio rerio OX=7955 GN=grk5l PE=3 SV=1
3	F1RAR9	0.0	626	588	0.526	0.515	F1RAR9_DANRE G protein-coupled receptor kinase OS=Danio rerio OX=7955 GN=si:dkey-171l20.1 PE=3 SV=1
4	O70293	0.0	1159	576	0.967	0.967	GRK6_MOUSE G protein-coupled receptor kinase 6 OS=Mus musculus OX=10090 GN=Grk6 PE=1 SV=1
5	P32298	0.0	761	578	0.651	0.649	GRK4_HUMAN G protein-coupled receptor kinase 4 OS=Homo sapiens OX=9606 GN=GRK4 PE=1 SV=3
6	P32866	0.0	561	714	0.491	0.396	GPRK2_DROME G protein-coupled receptor kinase 2 OS=Drosophila melanogaster OX=7227 GN=Gprk2 PE=1 SV=3
7	P34947	0.0	820	590	0.701	0.685	GRK5_HUMAN G protein-coupled receptor kinase 5 OS=Homo sapiens OX=9606 GN=GRK5 PE=1 SV=1
8	P43250	0.0	1191	576	1.000	1.000	GRK6_HUMAN G protein-coupled receptor kinase 6 OS=Homo sapiens OX=9606 GN=GRK6 PE=1 SV=2
9	P70507	0.0	746	575	0.637	0.638	GRK4_RAT G protein-coupled receptor kinase 4 OS=Rattus norvegicus OX=10116 GN=Grk4 PE=1 SV=1
10	P97711	0.0	1153	576	0.967	0.967	GRK6_RAT G protein-coupled receptor kinase 6 OS=Rattus norvegicus OX=10116 GN=Grk6 PE=1 SV=1
11	Q08CJ6	0.0	828	573	0.708	0.712	Q08CJ6_DANRE G protein-coupled receptor kinase OS=Danio rerio OX=7955 GN=zgc:153020 PE=1 SV=1
12	Q62833	0.0	818	590	0.698	0.681	GRK5_RAT G protein-coupled receptor kinase 5 OS=Rattus norvegicus OX=10116 GN=Grk5 PE=1 SV=1
13	Q8VEB1	0.0	820	590	0.698	0.681	GRK5_MOUSE G protein-coupled receptor kinase 5 OS=Mus musculus OX=10090 GN=Grk5 PE=1 SV=2
14	Q1XHM0	4.04e-175	509	563	0.457	0.467	Q1XHM0_DANRE G protein-coupled receptor kinase OS=Danio rerio OX=7955 GN=grk1 PE=1 SV=1
15	A9JRC5	8.98e-174	501	440	0.425	0.557	A9JRC5_DANRE G protein-coupled receptor kinase (Fragment) OS=Danio rerio OX=7955 GN=LOC560806 PE=2 SV=1
16	Q15835	5.26e-173	503	563	0.455	0.465	GRK1_HUMAN Rhodopsin kinase GRK1 OS=Homo sapiens OX=9606 GN=GRK1 PE=1 SV=1
17	Q9WVL4	7.70e-173	503	564	0.457	0.466	GRK1_MOUSE Rhodopsin kinase GRK1 OS=Mus musculus OX=10090 GN=Grk1 PE=1 SV=1
18	Q63651	7.39e-171	498	564	0.455	0.465	GRK1_RAT Rhodopsin kinase GRK1 OS=Rattus norvegicus OX=10116 GN=Grk1 PE=1 SV=1
19	P28327	1.43e-169	494	561	0.455	0.467	GRK1_BOVIN Rhodopsin kinase GRK1 OS=Bos taurus OX=9913 GN=GRK1 PE=1 SV=1
20	Q49HN0	4.04e-164	481	559	0.429	0.442	Q49HN0_DANRE G protein-coupled receptor kinase OS=Danio rerio OX=7955 GN=GRK1B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14531 Kinase-like	0.014	26.3	Kinase-like
2	PF00069 Pkinase	2.2e-65	232.3	Protein kinase domain
3	PF17667 Pkinase_fungal	0.46	20.8	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	2.7e-32	123.7	Protein tyrosine and serine/threonine kinase
5	PF00615 RGS	2.2e-16	71.6	Regulator of G protein signaling domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000005048

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000000315	0.924	Arrestin, beta 1
2	60711.ENSCSAP00000012365	0.879	Chemokine (C-X-C motif) receptor 4
3	60711.ENSCSAP00000009624	0.873	Opioid receptor, mu 1
4	60711.ENSCSAP00000006178	0.831	Smoothened, frizzled class receptor
5	60711.ENSCSAP00000018294	0.820	Chemokine (C-X-C motif) receptor 2
6	60711.ENSCSAP00000018295	0.795	Chemokine (C-X-C motif) receptor 1
7	60711.ENSCSAP00000019212	0.778	Adrenoceptor beta 2, surface
8	60711.ENSCSAP00000005164	0.777	Myotrophin
9	60711.ENSCSAP00000012314	0.761	Chemokine (C-C motif) receptor 1
10	60711.ENSCSAP00000018293	0.761	Chemokine (C-C motif) receptor 3
11	60711.ENSCSAP00000018446	0.759	Chemokine (C-C motif) receptor 4
12	60711.ENSCSAP00000018296	0.754	Chemokine (C-C motif) receptor 2
13	60711.ENSCSAP00000018297	0.754	Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation (By similarity)
14	60711.ENSCSAP00000015483	0.732	Chemokine (C-X-C motif) receptor 5
15	60711.ENSCSAP00000003226	0.718	GIT ArfGAP 1
16	60711.ENSCSAP00000009268	0.715	Arrestin, beta 2
17	60711.ENSCSAP00000013954	0.702	G protein subunit beta 2
18	60711.ENSCSAP00000008296	0.698	Belongs to the G-protein coupled receptor 1 family.
19	60711.ENSCSAP00000007427	0.691	Chemokine (C-X-C motif) receptor 3
20	60711.ENSCSAP00000012330	0.691	Chemokine (C-C motif) receptor 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0004703	0.803	G protein-coupled receptor kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0009966	0.986	regulation of signal transduction
GO:0050896	0.985	response to stimulus
GO:0008277	0.984	regulation of G protein-coupled receptor signaling pathway
GO:0042221	0.958	response to chemical
GO:0045744	0.855	negative regulation of G protein-coupled receptor signaling pathway
GO:0007165	0.832	signal transduction
GO:0023058	0.809	adaptation of signaling pathway
GO:0010033	0.762	response to organic substance
GO:0048518	0.759	positive regulation of biological process
GO:0032501	0.708	multicellular organismal process
GO:0044419	0.634	biological process involved in interspecies interaction between organisms
GO:0007186	0.582	G protein-coupled receptor signaling pathway
GO:0048522	0.580	positive regulation of cellular process
GO:0032879	0.540	regulation of localization
GO:0051049	0.534	regulation of transport
GO:0009605	0.520	response to external stimulus
GO:0008152	0.513	metabolic process
GO:1901700	0.489	response to oxygen-containing compound
GO:0070887	0.463	cellular response to chemical stimulus
GO:0032502	0.461	developmental process
GO:0071704	0.451	organic substance metabolic process
GO:0044237	0.437	cellular metabolic process
GO:0044238	0.417	primary metabolic process
GO:0010243	0.388	response to organonitrogen compound
GO:0048856	0.372	anatomical structure development
GO:0006807	0.339	nitrogen compound metabolic process
GO:0006468	0.330	protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.945	intracellular anatomical structure
GO:0005829	0.889	cytosol
GO:0043226	0.719	organelle
GO:0043227	0.673	membrane-bounded organelle
GO:0042995	0.599	cell projection
GO:0120025	0.538	plasma membrane bounded cell projection
GO:0043005	0.533	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:12008	0.803	[G-protein-coupled receptor] + ATP = [G-protein-coupled receptor]-phosphate + ADP + H(+)
EC:2.7.11.16	0.803	[G-protein-coupled receptor] kinase.

[back to server]