StarFunc result for job id P43251

User Input

>input (543 residues)
MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVA
AVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNF
TRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCH
SSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRF
GIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAAN
VHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSK
FLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSN
GLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATG
IFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLY
ERD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43251	1.000	1.000	0.000	543	1.000	1.000	P43251.pdb.gz	BTD_HUMAN Biotinidase OS=Homo sapiens OX=9606 GN=BTD PE=1 SV=2
2	AFDB:Q8CIF4	0.906	0.945	1.817E-101	520	0.812	0.848	Q8CIF4.pdb.gz	BTD_MOUSE Biotinidase OS=Mus musculus OX=10090 GN=Btd PE=1 SV=2
3	AFDB:O95497	0.798	0.843	1.510E-60	513	0.381	0.404	O95497.pdb.gz	VNN1_HUMAN Pantetheinase OS=Homo sapiens OX=9606 GN=VNN1 PE=1 SV=2
4	AFDB:Q9Z0K8	0.803	0.850	3.725E-59	512	0.378	0.400	Q9Z0K8.pdb.gz	VNN1_MOUSE Pantetheinase OS=Mus musculus OX=10090 GN=Vnn1 PE=1 SV=3
5	PDB:4cygA	0.789	0.922	2.376E-58	463	0.376	0.441	4cygA.pdb.gz	The Structure of Vanin-1: A Key Enzyme Linking Metabolic Disease and Inflammation
6	AFDB:Q9QZ25	0.788	0.854	9.732E-58	500	0.365	0.396	Q9QZ25.pdb.gz	VNN3_MOUSE Vascular non-inflammatory molecule 3 OS=Mus musculus OX=10090 GN=Vnn3 PE=2 SV=3
7	AFDB:O95498	0.796	0.831	3.845E-57	520	0.350	0.365	O95498.pdb.gz	VNN2_HUMAN Pantetheine hydrolase VNN2 OS=Homo sapiens OX=9606 GN=VNN2 PE=1 SV=3
8	AFDB:C6KYS2	0.729	0.788	3.646E-44	501	0.271	0.293	C6KYS2.pdb.gz	SYMPP_STHOU Symplectin OS=Sthenoteuthis oualaniensis OX=34553 GN=sympp PE=1 SV=2
9	AFDB:Q9W430	0.663	0.652	2.517E-33	553	0.245	0.241	Q9W430.pdb.gz	Q9W430_DROME Biotinidase OS=Drosophila melanogaster OX=7227 GN=Btnd PE=2 SV=1
10	PDB:2w1vA	0.366	0.696	8.418E-14	274	0.103	0.204	2w1vA.pdb.gz
11	PDB:1f89A	0.370	0.706	1.187E-13	271	0.105	0.210	1f89A.pdb.gz
12	PDB:2uxyA	0.379	0.586	2.359E-13	341	0.101	0.161	2uxyA.pdb.gz
13	AFDB:Q8RUF8	0.373	0.536	4.590E-13	369	0.107	0.157	Q8RUF8.pdb.gz	NILP3_ARATH Omega-amidase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NLP3 PE=1 SV=1
14	AFDB:Q94JV5	0.400	0.676	6.110E-13	307	0.114	0.202	Q94JV5.pdb.gz	NILP2_ARATH Deaminated glutathione amidase, chloroplastic/cytosolic OS=Arabidopsis thaliana OX=3702 GN=NLP2 PE=1 SV=1
15	PDB:4hg3A	0.360	0.609	2.765E-12	304	0.087	0.155	4hg3A.pdb.gz	Structures of enzyme-intermediate complexes of yeast Nit2: insights into its catalytic mechanism and different substrate specificity compared with mammalian Nit2
16	PDB:1emsA	0.363	0.468	4.628E-12	412	0.098	0.129	1emsA.pdb.gz
17	PDB:6ftqA	0.378	0.592	2.171E-11	332	0.090	0.148	6ftqA.pdb.gz
18	PDB:2vhiA	0.364	0.553	4.075E-11	348	0.079	0.124	2vhiA.pdb.gz
19	PDB:6i00A	0.378	0.682	4.569E-11	289	0.107	0.201	6i00A.pdb.gz
20	PDB:2vhhC	0.382	0.530	2.403E-10	382	0.083	0.118	2vhhC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43251	0.0	1138	543	1.000	1.000	BTD_HUMAN Biotinidase OS=Homo sapiens OX=9606 GN=BTD PE=1 SV=2
2	Q8CIF4	0.0	945	520	0.812	0.848	BTD_MOUSE Biotinidase OS=Mus musculus OX=10090 GN=Btd PE=1 SV=2
3	O95497	4.99e-131	393	513	0.385	0.407	VNN1_HUMAN Pantetheinase OS=Homo sapiens OX=9606 GN=VNN1 PE=1 SV=2
4	Q9Z0K8	4.03e-129	388	512	0.381	0.404	VNN1_MOUSE Pantetheinase OS=Mus musculus OX=10090 GN=Vnn1 PE=1 SV=3
5	Q9QZ25	2.68e-126	380	500	0.383	0.416	VNN3_MOUSE Vascular non-inflammatory molecule 3 OS=Mus musculus OX=10090 GN=Vnn3 PE=2 SV=3
6	O95498	5.65e-119	362	520	0.359	0.375	VNN2_HUMAN Pantetheine hydrolase VNN2 OS=Homo sapiens OX=9606 GN=VNN2 PE=1 SV=3
7	C6KYS2	4.10e-62	214	501	0.280	0.303	SYMPP_STHOU Symplectin OS=Sthenoteuthis oualaniensis OX=34553 GN=sympp PE=1 SV=2
8	Q9W430	1.30e-38	150	553	0.262	0.257	Q9W430_DROME Biotinidase OS=Drosophila melanogaster OX=7227 GN=Btnd PE=2 SV=1
9	Q9NQR4	5.38e-04	44.3	276	0.070	0.138	NIT2_HUMAN Omega-amidase NIT2 OS=Homo sapiens OX=9606 GN=NIT2 PE=1 SV=1
10	V9HW91	5.38e-04	44.3	276	0.070	0.138	V9HW91_HUMAN Epididymis secretory sperm binding protein Li 8a OS=Homo sapiens OX=9606 GN=HEL-S-8a PE=2 SV=1
11	P49954	0.001	43.9	291	0.096	0.179	NIT3_YEAST Omega-amidase NIT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NIT3 PE=1 SV=1
12	H7C579	0.002	42.4	265	0.061	0.125	H7C579_HUMAN Nitrilase family member 2 (Fragment) OS=Homo sapiens OX=9606 GN=NIT2 PE=1 SV=8
13	O76464	0.018	40.0	460	0.046	0.054	NFT1_DROME Nitrilase and fragile histidine triad fusion protein NitFhit OS=Drosophila melanogaster OX=7227 GN=NitFhit PE=1 SV=1
14	Q9JHW2	0.019	39.7	276	0.064	0.127	NIT2_MOUSE Omega-amidase NIT2 OS=Mus musculus OX=10090 GN=Nit2 PE=1 SV=1
15	Q10166	0.022	39.7	322	0.092	0.155	YAUB_SCHPO Hydrolase C26A3.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26A3.11 PE=3 SV=1
16	Q94JV5	0.026	39.3	307	0.048	0.085	NILP2_ARATH Deaminated glutathione amidase, chloroplastic/cytosolic OS=Arabidopsis thaliana OX=3702 GN=NLP2 PE=1 SV=1
17	O76463	0.10	37.7	440	0.085	0.105	NFT1_CAEEL Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans OX=6239 GN=nft-1 PE=1 SV=1
18	Q8RUF8	0.70	35.0	369	0.044	0.065	NILP3_ARATH Omega-amidase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NLP3 PE=1 SV=1
19	P11436	1.4	33.9	346	0.055	0.087	AMIE_PSEAE Aliphatic amidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=amiE PE=1 SV=2
20	P86938	1.5	34.3	839	0.041	0.026	JBP1_TRYB2 Thymine dioxygenase JBP1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=JBP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00795 CN_hydrolase	4e-10	51.1	Carbon-nitrogen hydrolase
2	PF19018 Vanin_C	8.1e-27	105.6	Vanin C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000025305

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000023914	0.967	Uncharacterized protein
2	9598.ENSPTRP00000043218	0.821	Aminoadipate-semialdehyde synthase
3	9598.ENSPTRP00000045149	0.682	Pyruvate carboxylase
4	9598.ENSPTRP00000005774	0.670	Tripeptidyl-peptidase 1
5	9598.ENSPTRP00000030994	0.663	Uncharacterized protein
6	9598.ENSPTRP00000026948	0.650	Methylcrotonoyl-CoA carboxylase 1 (Alpha)
7	9598.ENSPTRP00000018197	0.648	Usher syndrome 1C binding protein 1
8	9598.ENSPTRP00000030207	0.647	Pan troglodytes phenylalanyl-tRNA synthetase 2, mitochondrial (FARS2), nuclear gene encoding mitochondrial protein, mRNA
9	9598.ENSPTRP00000010202	0.635	Propionyl CoA carboxylase, alpha polypeptide
10	9598.ENSPTRP00000029062	0.613	Methylcrotonoyl-CoA carboxylase 2 (Beta)
11	9598.ENSPTRP00000041451	0.606	Glycerate kinase
12	9598.ENSPTRP00000025988	0.583	Ankyrin repeat and SOCS box containing 14
13	9598.ENSPTRP00000034295	0.569	Acid ceramidase
14	9598.ENSPTRP00000054006	0.569	Uncharacterized protein
15	9598.ENSPTRP00000016888	0.565	Uncharacterized protein
16	9598.ENSPTRP00000009968	0.554	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
17	9598.ENSPTRP00000014317	0.551	Glycine cleavage system H protein
18	9598.ENSPTRP00000011226	0.548	Uncharacterized protein
19	9598.ENSPTRP00000016345	0.543	Glutamate receptor, ionotropic, N-methyl D-aspartate 2C
20	9598.ENSPTRP00000016389	0.542	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016811	1.000	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0047708	0.923	biotinidase activity
GO:0005488	0.767	binding
GO:0005515	0.598	protein binding
GO:0097367	0.308	carbohydrate derivative binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0071704	0.998	organic substance metabolic process
GO:0006807	0.998	nitrogen compound metabolic process
GO:1901564	0.993	organonitrogen compound metabolic process
GO:0006767	0.986	water-soluble vitamin metabolic process
GO:0043436	0.986	oxoacid metabolic process
GO:0043603	0.985	amide metabolic process
GO:0032787	0.975	monocarboxylic acid metabolic process
GO:1901360	0.968	organic cyclic compound metabolic process
GO:0006790	0.957	sulfur compound metabolic process
GO:0046483	0.917	heterocycle metabolic process
GO:0032501	0.477	multicellular organismal process
GO:0007275	0.436	multicellular organism development
GO:0044238	0.365	primary metabolic process
GO:0048731	0.329	system development
GO:0006768	0.307	biotin metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0005739	0.973	mitochondrion
GO:0005759	0.738	mitochondrial matrix
GO:0031982	0.656	vesicle
GO:0016020	0.390	membrane
GO:0043230	0.319	extracellular organelle
GO:1903561	0.311	extracellular vesicle
GO:0070062	0.300	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.1.-	1.000	In linear amides.
RHEA:13081	0.923	biotin amide + H2O = biotin + NH4(+)
EC:3.5.1.12	0.923	biotinidase.

[back to server]