StarFunc result for job id P43268

User Input

>input (484 residues)
MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSHF
QETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHH
GEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYLGE
HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQP
AVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYE
KPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFI
AWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF
VCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKG
GYSY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28322	0.335	0.335	3.241E-65	485	0.924	0.922	P28322.pdb.gz	ETV4_MOUSE ETS translocation variant 4 OS=Mus musculus OX=10090 GN=Etv4 PE=2 SV=2
2	AFDB:P41164	0.300	0.303	1.383E-40	477	0.548	0.556	P41164.pdb.gz	ETV1_MOUSE ETS translocation variant 1 OS=Mus musculus OX=10090 GN=Etv1 PE=1 SV=1
3	AFDB:D4AC56	0.221	0.211	8.338E-34	510	0.533	0.506	D4AC56.pdb.gz	D4AC56_RAT ETS variant transcription factor 5 OS=Rattus norvegicus OX=10116 GN=Etv5 PE=3 SV=1
4	AFDB:A0A2R8QC01	0.269	0.251	1.388E-33	526	0.500	0.460	A0A2R8QC01.pdb.gz	A0A2R8QC01_DANRE ETS variant transcription factor 5b OS=Danio rerio OX=7955 GN=cb805 PE=3 SV=1
5	AFDB:B0S6S7	0.268	0.251	1.127E-31	524	0.494	0.456	B0S6S7.pdb.gz	B0S6S7_DANRE ETS translocation variant 5 isoform 1 OS=Danio rerio OX=7955 GN=etv5 PE=3 SV=1
6	AFDB:A0A024R985	0.183	0.205	3.634E-4	431	0.136	0.153	A0A024R985.pdb.gz
7	AFDB:P41969	0.170	0.191	1.905E-3	429	0.132	0.149	P41969.pdb.gz	ELK1_MOUSE ETS domain-containing protein Elk-1 OS=Mus musculus OX=10090 GN=Elk1 PE=1 SV=3
8	PDB:6w6wC	0.096	0.130	7.507E-2	323	0.039	0.059	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
9	AFDB:R9PY21	0.057	0.043	7.674E-2	720	0.161	0.108	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
10	PDB:1ldjA	0.106	0.075	1.173E-1	725	0.021	0.014	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
11	AFDB:A0A0B4J1A5	0.070	0.057	1.278E-1	626	0.174	0.134	A0A0B4J1A5.pdb.gz	A0A0B4J1A5_DANRE EWS RNA-binding protein 1a OS=Danio rerio OX=7955 GN=EWSR1 PE=1 SV=1
12	AFDB:Q8CHD8	0.099	0.055	2.925E-1	1047	0.153	0.071	Q8CHD8.pdb.gz	RFIP3_MOUSE Rab11 family-interacting protein 3 OS=Mus musculus OX=10090 GN=Rab11fip3 PE=1 SV=2
13	PDB:1ft9A	0.116	0.241	3.936E-1	210	0.035	0.081	1ft9A.pdb.gz	Structure of the CO sensing transcription activator CooA.
14	PDB:5k1yD	0.093	0.384	3.936E-1	92	0.021	0.109	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
15	PDB:4ev0D	0.124	0.260	4.194E-1	214	0.041	0.093	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
16	PDB:3cuqC	0.122	0.287	4.470E-1	173	0.025	0.069	3cuqC.pdb.gz
17	PDB:4byyA	0.114	0.224	4.470E-1	226	0.025	0.053	4byyA.pdb.gz
18	PDB:2xhkB	0.121	0.227	5.412E-1	217	0.023	0.051	2xhkB.pdb.gz	Structural Basis for the Regulation of Ntca-Dependent Transcription by Proteins Pipx and Pii.
19	PDB:6dk4A	0.099	0.269	5.768E-1	135	0.023	0.081	6dk4A.pdb.gz	Crystal structure of Campylobacter jejuni peroxide regulator.
20	PDB:3m8eA	0.098	0.361	6.148E-1	101	0.021	0.099	3m8eA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7Z5F4	0.0	833	430	0.872	0.981	B7Z5F4_HUMAN ETS variant transcription factor 4 OS=Homo sapiens OX=9606 GN=ETV4 PE=1 SV=1
2	P28322	0.0	904	485	0.924	0.922	ETV4_MOUSE ETS translocation variant 4 OS=Mus musculus OX=10090 GN=Etv4 PE=2 SV=2
3	P43268	0.0	989	484	1.000	1.000	ETV4_HUMAN ETS translocation variant 4 OS=Homo sapiens OX=9606 GN=ETV4 PE=1 SV=3
4	Q9PUQ1	0.0	522	494	0.628	0.615	ETV4_DANRE ETS translocation variant 4 OS=Danio rerio OX=7955 GN=etv4 PE=1 SV=2
5	P41164	1.42e-161	468	477	0.558	0.566	ETV1_MOUSE ETS translocation variant 1 OS=Mus musculus OX=10090 GN=Etv1 PE=1 SV=1
6	P50549	3.54e-161	466	477	0.558	0.566	ETV1_HUMAN ETS translocation variant 1 OS=Homo sapiens OX=9606 GN=ETV1 PE=1 SV=2
7	D4AC56	1.04e-130	390	510	0.525	0.498	D4AC56_RAT ETS variant transcription factor 5 OS=Rattus norvegicus OX=10116 GN=Etv5 PE=3 SV=1
8	Q9CXC9	4.46e-130	389	510	0.525	0.498	ETV5_MOUSE ETS translocation variant 5 OS=Mus musculus OX=10090 GN=Etv5 PE=2 SV=1
9	P41161	1.04e-128	385	510	0.529	0.502	ETV5_HUMAN ETS translocation variant 5 OS=Homo sapiens OX=9606 GN=ETV5 PE=1 SV=1
10	A0A8I6AQT3	6.65e-126	378	528	0.523	0.479	A0A8I6AQT3_RAT ETS variant transcription factor 5 OS=Rattus norvegicus OX=10116 GN=Etv5 PE=3 SV=1
11	F1QK52	3.59e-122	369	524	0.508	0.469	F1QK52_DANRE ETS variant transcription factor 5b OS=Danio rerio OX=7955 GN=cb805 PE=3 SV=1
12	A0A2R8QC01	2.50e-120	364	526	0.508	0.468	A0A2R8QC01_DANRE ETS variant transcription factor 5b OS=Danio rerio OX=7955 GN=cb805 PE=3 SV=1
13	F1Q6X6	9.09e-118	357	522	0.492	0.456	F1Q6X6_DANRE ETS translocation variant 5 isoform 2 OS=Danio rerio OX=7955 GN=etv5 PE=3 SV=3
14	B0S6S7	6.30e-116	353	524	0.492	0.454	B0S6S7_DANRE ETS translocation variant 5 isoform 1 OS=Danio rerio OX=7955 GN=etv5 PE=3 SV=1
15	Q8MRW5	1.18e-52	190	640	0.190	0.144	ET96B_DROME ETV5-related protein Ets96B OS=Drosophila melanogaster OX=7227 GN=Ets96B PE=2 SV=1
16	A0A590UJP9	6.53e-32	130	504	0.118	0.113	A0A590UJP9_HUMAN ETS proto-oncogene 2, transcription factor OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
17	P27577	1.12e-31	128	440	0.116	0.127	ETS1_MOUSE Protein C-ets-1 OS=Mus musculus OX=10090 GN=Ets1 PE=1 SV=2
18	P14921	1.18e-31	128	441	0.116	0.127	ETS1_HUMAN Protein C-ets-1 OS=Homo sapiens OX=9606 GN=ETS1 PE=1 SV=1
19	P41156	1.19e-31	128	441	0.116	0.127	ETS1_RAT Protein C-ets-1 OS=Rattus norvegicus OX=10116 GN=Ets1 PE=1 SV=1
20	P15036	5.52e-31	127	469	0.112	0.115	ETS2_HUMAN Protein C-ets-2 OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	6.8e-31	117.7	Ets-domain
2	PF04621 ETS_PEA3_N	2e-105	365.2	PEA3 subfamily ETS-domain transcription factor N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321835

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324856	0.951	Serine/threonine-protein kinase STK11
2	9606.ENSP00000361066	0.923	Nuclear receptor coactivator 3
3	9606.ENSP00000356641	0.893	E3 ubiquitin-protein ligase RFWD2
4	9606.ENSP00000321797	0.791	Fibroblast growth factor 8
5	9606.ENSP00000334122	0.770	Fibroblast growth factor 3
6	9606.ENSP00000344967	0.764	Protein sprouty homolog 4
7	9606.ENSP00000357000	0.749	Upstream stimulatory factor 1
8	9606.ENSP00000381588	0.739	Transmembrane protease serine 2
9	9606.ENSP00000361746	0.720	Eppin
10	9606.ENSP00000400142	0.717	RNA-binding protein EWS
11	9606.ENSP00000264664	0.711	Fibroblast growth factor 10
12	9606.ENSP00000261845	0.707	Mitogen-activated protein kinase 6
13	9606.ENSP00000279488	0.678	Dual specificity protein phosphatase 6
14	9606.ENSP00000360266	0.660	Transcription factor AP-1
15	9606.ENSP00000227918	0.649	Mammaglobin-A
16	9606.ENSP00000408792	0.631	Transcription factor Sp8
17	9606.ENSP00000437955	0.627	Hypoxia-inducible factor 1-alpha
18	9606.ENSP00000356113	0.613	Solute carrier family 45 member 3
19	9606.ENSP00000458065	0.613	Double homeobox protein 4
20	9606.ENSP00000451411	0.611	Double homeobox 4 like 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	0.999	sequence-specific DNA binding
GO:0140110	0.837	transcription regulator activity
GO:0005515	0.832	protein binding
GO:0003700	0.798	DNA-binding transcription factor activity
GO:0003690	0.692	double-stranded DNA binding
GO:1990837	0.670	sequence-specific double-stranded DNA binding
GO:0000976	0.605	transcription cis-regulatory region binding
GO:0000981	0.364	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.996	regulation of gene expression
GO:2001141	0.995	regulation of RNA biosynthetic process
GO:0009987	0.986	cellular process
GO:0010557	0.986	positive regulation of macromolecule biosynthetic process
GO:0045935	0.986	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0045893	0.949	positive regulation of DNA-templated transcription
GO:0032501	0.917	multicellular organismal process
GO:0048856	0.905	anatomical structure development
GO:0050896	0.899	response to stimulus
GO:0006357	0.891	regulation of transcription by RNA polymerase II
GO:0007275	0.853	multicellular organism development
GO:0051239	0.838	regulation of multicellular organismal process
GO:0048731	0.830	system development
GO:0045944	0.802	positive regulation of transcription by RNA polymerase II
GO:0045595	0.785	regulation of cell differentiation
GO:0045682	0.729	regulation of epidermis development
GO:0048513	0.721	animal organ development
GO:2000026	0.715	regulation of multicellular organismal development
GO:0030154	0.683	cell differentiation
GO:0048519	0.674	negative regulation of biological process
GO:0009653	0.627	anatomical structure morphogenesis
GO:0071704	0.564	organic substance metabolic process
GO:0042221	0.560	response to chemical
GO:0044238	0.544	primary metabolic process
GO:0048523	0.536	negative regulation of cellular process
GO:0042127	0.517	regulation of cell population proliferation
GO:0006807	0.516	nitrogen compound metabolic process
GO:0051240	0.453	positive regulation of multicellular organismal process
GO:0043170	0.447	macromolecule metabolic process
GO:0044237	0.441	cellular metabolic process
GO:0009888	0.300	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005730	0.533	nucleolus
GO:0005694	0.525	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]