StarFunc result for job id P43304

User Input

>input (727 residues)
MAFQKAVKGTILVGGGALATVLGLSQFAHYRRKQMNLAYVKAADCISEPVNREPPSREAQ
LLTLQNTSEFDILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPQTGKVRVSGARCKDVLTGQEFDVRAKCVINATGPFTDSVRKM
DDKDAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAVKTHNLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDYKKQEQLETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35571	0.882	0.882	0.000	727	0.916	0.916	P35571.pdb.gz	GPDM_RAT Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpd2 PE=1 SV=1
2	AFDB:Q7K569	0.846	0.849	2.670E-96	724	0.608	0.610	Q7K569.pdb.gz	Q7K569_DROME Glycerol-3-phosphate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Gpo1 PE=1 SV=1
3	AFDB:C8VRM5	0.757	0.785	5.715E-74	700	0.447	0.464	C8VRM5.pdb.gz	C8VRM5_EMENI Glycerol-3-phosphate dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01396 PE=3 SV=1
4	AFDB:Q9SS48	0.734	0.847	4.570E-67	629	0.403	0.466	Q9SS48.pdb.gz	SDP6_ARATH Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDP6 PE=1 SV=1
5	AFDB:A0A1D8PMP1	0.713	0.795	7.234E-64	650	0.354	0.395	A0A1D8PMP1.pdb.gz	A0A1D8PMP1_CANAL Glycerol-3-phosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GUT2 PE=3 SV=1
6	AFDB:O14400	0.722	0.807	5.177E-63	649	0.363	0.407	O14400.pdb.gz	GPDM_SCHPO Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gut2 PE=3 SV=1
7	AFDB:P32191	0.716	0.800	1.221E-62	649	0.359	0.402	P32191.pdb.gz	GPDM_YEAST Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUT2 PE=1 SV=2
8	AFDB:Q384S7	0.703	0.843	3.693E-54	603	0.297	0.358	Q384S7.pdb.gz	Q384S7_TRYB2 Glycerol-3-phosphate dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5280 PE=3 SV=1
9	AFDB:Q4Q8P6	0.699	0.831	8.434E-53	608	0.294	0.352	Q4Q8P6.pdb.gz	Q4Q8P6_LEIMA Glycerol-3-phosphate dehydrogenase OS=Leishmania major OX=5664 GN=LMJF_28_0240 PE=3 SV=2
10	AFDB:P9WN79	0.676	0.836	6.710E-49	585	0.264	0.328	P9WN79.pdb.gz	GLPD2_MYCTU Glycerol-3-phosphate dehydrogenase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glpD2 PE=1 SV=1
11	PDB:2qcuB	0.596	0.849	2.083E-35	501	0.212	0.307	2qcuB.pdb.gz	Structure of glycerol-3-phosphate dehydrogenase, an essential monotopic membrane enzyme involved in respiration and metabolism.
12	PDB:4yshA	0.385	0.711	2.260E-17	370	0.098	0.192	4yshA.pdb.gz	Crystal structure of glycine oxidase from Geobacillus kaustophilus
13	PDB:3if9A	0.368	0.689	4.436E-16	364	0.095	0.190	3if9A.pdb.gz	Glyphosate resistance by engineering the flavoenzyme glycine oxidase.
14	PDB:3nycA	0.385	0.695	2.594E-15	381	0.094	0.178	3nycA.pdb.gz	Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
15	PDB:4pabB	0.373	0.334	1.013E-14	824	0.105	0.092	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
16	PDB:2uzzB	0.351	0.628	2.742E-12	372	0.084	0.164	2uzzB.pdb.gz	The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
17	PDB:3awiD	0.345	0.377	8.478E-11	659	0.076	0.083	3awiD.pdb.gz	Crystal structure of the bifunctional tRNA modification enzyme MnmC from Escherichia coli
18	PDB:5ez7A	0.347	0.640	9.553E-10	363	0.080	0.160	5ez7A.pdb.gz	Crystal structure of the flavoenzyme PA4991 from Pseudomonas aeruginosa.
19	PDB:4yjdA	0.313	0.612	1.430E-9	342	0.074	0.158	4yjdA.pdb.gz	Crystal structure of DAAO variant
20	PDB:2du8A	0.307	0.602	2.369E-9	340	0.072	0.153	2du8A.pdb.gz	Crystal structure of human D-amino acid oxidase: Context-dependent variability of the backbone conformation of the VAAGL hydrophobic stretch located at the si-face of the flavin ring

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C8VRM5	0.0	655	700	0.433	0.450	C8VRM5_EMENI Glycerol-3-phosphate dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01396 PE=3 SV=1
2	P35571	0.0	1381	727	0.916	0.916	GPDM_RAT Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpd2 PE=1 SV=1
3	P43304	0.0	1511	727	1.000	1.000	GPDM_HUMAN Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GPD2 PE=1 SV=3
4	Q64521	0.0	1397	727	0.933	0.933	GPDM_MOUSE Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Gpd2 PE=1 SV=2
5	Q7K569	0.0	880	724	0.609	0.612	Q7K569_DROME Glycerol-3-phosphate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Gpo1 PE=1 SV=1
6	Q9SS48	0.0	533	629	0.404	0.467	SDP6_ARATH Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDP6 PE=1 SV=1
7	A0A1D8PMP1	1.73e-157	473	650	0.358	0.400	A0A1D8PMP1_CANAL Glycerol-3-phosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GUT2 PE=3 SV=1
8	O14400	8.19e-157	471	649	0.360	0.404	GPDM_SCHPO Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gut2 PE=3 SV=1
9	P32191	2.65e-151	456	649	0.365	0.408	GPDM_YEAST Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUT2 PE=1 SV=2
10	Q4Q8P6	1.92e-108	344	608	0.307	0.367	Q4Q8P6_LEIMA Glycerol-3-phosphate dehydrogenase OS=Leishmania major OX=5664 GN=LMJF_28_0240 PE=3 SV=2
11	Q384S7	1.71e-104	333	603	0.292	0.352	Q384S7_TRYB2 Glycerol-3-phosphate dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5280 PE=3 SV=1
12	P9WN79	1.65e-79	267	585	0.245	0.304	GLPD2_MYCTU Glycerol-3-phosphate dehydrogenase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glpD2 PE=1 SV=1
13	P9WN81	6.97e-47	176	516	0.237	0.333	GLPD1_MYCTU Glycerol-3-phosphate dehydrogenase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glpD1 PE=1 SV=1
14	P13035	1.59e-39	155	501	0.210	0.305	GLPD_ECOLI Aerobic glycerol-3-phosphate dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=glpD PE=1 SV=3
15	P0A9C0	3.27e-19	94.0	542	0.177	0.238	GLPA_ECOLI Anaerobic glycerol-3-phosphate dehydrogenase subunit A OS=Escherichia coli (strain K12) OX=83333 GN=glpA PE=1 SV=1
16	Q93NB6	2.53e-17	83.6	208	0.094	0.327	Q93NB6_YERPE Glycerol-3-phosphate dehydrogenase (Fragment) OS=Yersinia pestis OX=632 GN=glpD PE=3 SV=1
17	Q72AQ2	5.21e-16	84.0	516	0.147	0.207	Q72AQ2_DESVH Anaerobic glycerol-3-phosphate dehydrogenase, A subunit, putative OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_1940 PE=1 SV=1
18	O23320	1.58e-08	56.6	151	0.037	0.179	CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana OX=3702 GN=CML8 PE=1 SV=1
19	P06787	7.60e-08	54.3	147	0.041	0.204	CALM_YEAST Calmodulin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CMD1 PE=1 SV=1
20	A0A1D8PMF8	1.15e-07	53.9	149	0.040	0.195	A0A1D8PMF8_CANAL Calmodulin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CMD1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01266 DAO	4.1e-48	176.4	FAD dependent oxidoreductase
2	PF16901 DAO_C	7e-37	137.5	C-terminal domain of alpha-glycerophosphate oxidase
3	PF00404 Dockerin_1	2.9e+02	13.1	Dockerin type I domain
4	PF00036 EF-hand_1	1.7e-06	38.2	EF hand
5	PF14788 EF-hand_10	1.9e+02	13.4	EF hand
6	PF12763 EF-hand_4	4.3e+02	12.3	Cytoskeletal-regulatory complex EF hand
7	PF13202 EF-hand_5	0.37	21.6	EF hand
8	PF13405 EF-hand_6	0.00013	32.5	EF-hand domain
9	PF13499 EF-hand_7	2.2e-08	45.7	EF-hand domain pair
10	PF13833 EF-hand_8	0.26	22.4	EF-hand domain pair
11	PF14658 EF-hand_9	9	18.1	EF-hand domain
12	PF00890 FAD_binding_2	0.00052	30.8	FAD binding domain
13	PF01494 FAD_binding_3	81	13.9	FAD binding domain
14	PF12831 FAD_oxidored	0.0071	27.3	FAD dependent oxidoreductase
15	PF01134 GIDA	0.019	25.7	Glucose inhibited division protein A
16	PF03486 HI0933_like	80	13.4	HI0933-like protein
17	PF13450 NAD_binding_8	51	15.5	NAD(P)-binding Rossmann-like domain
18	PF07992 Pyr_redox_2	2.8	18.7	Pyridine nucleotide-disulphide oxidoreductase
19	PF13738 Pyr_redox_3	4e+02	11.6	Pyridine nucleotide-disulphide oxidoreductase
20	PF10591 SPARC_Ca_bdg	7.6e+02	11.9	Secreted protein acidic and rich in cysteine Ca binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308610

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301149	0.963	Glycerol-3-phosphate dehydrogenase 1
2	9606.ENSP00000378360	0.946	Triokinase/FMN cyclase
3	9606.ENSP00000265276	0.932	Glycerol-3-phosphate acyltransferase 1, mitochondrial
4	9606.ENSP00000355607	0.923	Glyceronephosphate O-acyltransferase
5	9606.ENSP00000389395	0.918	Glycerol-3-phosphate acyltransferase 2, mitochondrial
6	9606.ENSP00000482571	0.910	Glycerol-3-phosphate acyltransferase 3
7	9606.ENSP00000380184	0.909	Glycerol-3-phosphate acyltransferase 4
8	9606.ENSP00000369099	0.904	Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
9	9606.ENSP00000285518	0.857	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
10	9606.ENSP00000401720	0.852	Glycerol kinase
11	9606.ENSP00000397908	0.848	Phosphatidate phosphatase LPIN1
12	9606.ENSP00000381140	0.843	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
13	9606.ENSP00000261596	0.834	Phosphatidate phosphatase LPIN2
14	9606.ENSP00000362354	0.833	Phosphatidate phosphatase LPIN3
15	9606.ENSP00000310551	0.831	Lysocardiolipin acyltransferase 1
16	9606.ENSP00000282541	0.826	Glycerol-3-phosphate dehydrogenase 1-like protein
17	9606.ENSP00000314036	0.818	1-acyl-sn-glycerol-3-phosphate acyltransferase delta
18	9606.ENSP00000360761	0.818	1-acyl-sn-glycerol-3-phosphate acyltransferase beta
19	9606.ENSP00000378877	0.818	1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
20	9606.ENSP00000329697	0.813	Phospholipid phosphatase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016614	1.000	oxidoreductase activity, acting on CH-OH group of donors
GO:0005488	0.937	binding
GO:0016616	0.618	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0043167	0.603	ion binding
GO:0005515	0.562	protein binding
GO:0004368	0.442	glycerol-3-phosphate dehydrogenase (quinone) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0044281	0.984	small molecule metabolic process
GO:0006793	0.975	phosphorus metabolic process
GO:0006796	0.953	phosphate-containing compound metabolic process
GO:0019637	0.945	organophosphate metabolic process
GO:1901135	0.941	carbohydrate derivative metabolic process
GO:0044238	0.922	primary metabolic process
GO:0006091	0.444	generation of precursor metabolites and energy
GO:0006807	0.404	nitrogen compound metabolic process
GO:1901615	0.302	organic hydroxy compound metabolic process
GO:1901564	0.301	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	1.000	organelle membrane
GO:0005739	1.000	mitochondrion
GO:0005740	0.985	mitochondrial envelope
GO:0031966	0.969	mitochondrial membrane
GO:0019866	0.934	organelle inner membrane
GO:0005743	0.894	mitochondrial inner membrane
GO:0032991	0.594	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.-.-	1.000	Acting on the CH-OH group of donors.
EC:1.1.1.-	0.618	With NAD(+) or NADP(+) as acceptor.
RHEA:18977	0.442	a quinone + sn-glycerol 3-phosphate = a quinol + dihydroxyacetone phosphate
EC:1.1.5.3	0.442	glycerol-3-phosphate dehydrogenase.

[back to server]