StarFunc result for job id P43353

User Input

>input (468 residues)
MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESE
VSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNL
TLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHR
FDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNA
GQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGC
GRVAIGGQSDESDRYIAPTVLVDVQEMEPVMQEEIFGPILPIVNVQSLDEAIEFINRREK
PLALYAFSNSSQVVKRVLTQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGRYHGKFSFD
TFSHHRACLLRSPGMEKLNALRYPPQSPRRLRMLLVAMEAQGCSCTLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43353	1.000	1.000	1.015E-93	468	1.000	1.000	P43353.pdb.gz	AL3B1_HUMAN Aldehyde dehydrogenase family 3 member B1 OS=Homo sapiens OX=9606 GN=ALDH3B1 PE=1 SV=1
2	AFDB:Q80VQ0	0.994	0.994	3.857E-84	468	0.838	0.838	Q80VQ0.pdb.gz	AL3B1_MOUSE Aldehyde dehydrogenase family 3 member B1 OS=Mus musculus OX=10090 GN=Aldh3b1 PE=1 SV=1
3	AFDB:J3QMK6	0.979	0.957	1.144E-79	479	0.780	0.762	J3QMK6.pdb.gz	AL3B3_MOUSE Aldehyde dehydrogenase family 3 member B3 OS=Mus musculus OX=10090 GN=Aldh3b3 PE=1 SV=1
4	AFDB:E9Q3E1	0.973	0.951	4.201E-79	479	0.786	0.768	E9Q3E1.pdb.gz	AL3B2_MOUSE Aldehyde dehydrogenase family 3 member B2 OS=Mus musculus OX=10090 GN=Aldh3b2 PE=1 SV=1
5	AFDB:P48448	0.805	0.977	1.363E-63	385	0.684	0.831	P48448.pdb.gz	AL3B2_HUMAN Aldehyde dehydrogenase family 3 member B2 OS=Homo sapiens OX=9606 GN=ALDH3B2 PE=2 SV=3
6	AFDB:Q99PH4	0.962	0.889	2.103E-63	507	0.521	0.481	Q99PH4.pdb.gz	Q99PH4_MOUSE Aldehyde dehydrogenase OS=Mus musculus OX=10090 GN=Aldh3a2 PE=3 SV=1
7	AFDB:P51648	0.955	0.922	6.564E-63	485	0.524	0.505	P51648.pdb.gz	AL3A2_HUMAN Aldehyde dehydrogenase family 3 member A2 OS=Homo sapiens OX=9606 GN=ALDH3A2 PE=1 SV=1
8	AFDB:P11883	0.941	0.972	4.619E-62	453	0.515	0.532	P11883.pdb.gz	AL3A1_RAT Aldehyde dehydrogenase, dimeric NADP-preferring OS=Rattus norvegicus OX=10116 GN=Aldh3a1 PE=1 SV=3
9	AFDB:P30838	0.946	0.977	4.619E-62	453	0.513	0.530	P30838.pdb.gz	AL3A1_HUMAN Aldehyde dehydrogenase, dimeric NADP-preferring OS=Homo sapiens OX=9606 GN=ALDH3A1 PE=1 SV=3
10	PDB:4l1oB	0.940	0.972	7.194E-61	452	0.511	0.529	4l1oB.pdb.gz	Discovery of indole-2,3-diones as novel class of inhibitors for ALDH isozymes.
11	PDB:4qgkA	0.956	0.970	1.859E-59	461	0.528	0.536	4qgkA.pdb.gz
12	PDB:1ad3A	0.937	0.982	5.495E-59	446	0.513	0.538	1ad3A.pdb.gz	The first structure of an aldehyde dehydrogenase reveals novel interactions between NAD and the Rossmann fold.
13	AFDB:Q2FWX9	0.947	0.965	8.437E-54	459	0.415	0.423	Q2FWX9.pdb.gz	DIALD_STAA8 4,4'-diaponeurosporen-aldehyde dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=aldH1 PE=1 SV=1
14	PDB:6k0zA	0.945	0.965	3.584E-51	458	0.412	0.421	6k0zA.pdb.gz
15	PDB:5mypA	0.924	0.893	2.811E-50	485	0.417	0.402	5mypA.pdb.gz
16	PDB:5ucdA	0.886	0.952	2.468E-43	435	0.346	0.372	5ucdA.pdb.gz	Structure and mechanism of benzaldehyde dehydrogenase from Pseudomonas putida ATCC 12633, a member of the Class 3 aldehyde dehydrogenase superfamily.
17	PDB:3iwjA	0.796	0.748	4.523E-31	500	0.244	0.228	3iwjA.pdb.gz	Structural and functional characterization of plant aminoaldehyde dehydrogenase from Pisum sativum with a broad specificity for natural and synthetic aminoaldehydes.
18	PDB:4i9bA	0.809	0.765	9.660E-31	496	0.241	0.228	4i9bA.pdb.gz	Plant ALDH10 family: identifying critical residues for substrate specificity and trapping a thiohemiacetal intermediate.
19	PDB:4v37A	0.822	0.779	1.412E-30	495	0.246	0.232	4v37A.pdb.gz	Identification of a Stable Thiohemiacetal Involving a Conserved Cysteine in the Substrate Inactivation of S. Oleracea Betaine Aldehyde Dehydrogenase
20	PDB:1wnbA	0.839	0.828	3.547E-30	474	0.231	0.228	1wnbA.pdb.gz	Crystal Structure and Kinetics Identify Escherichia coli YdcW Gene Product as a Medium-chain Aldehyde Dehydrogenase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q3E1	0.0	780	479	0.788	0.770	AL3B2_MOUSE Aldehyde dehydrogenase family 3 member B2 OS=Mus musculus OX=10090 GN=Aldh3b2 PE=1 SV=1
2	J3QMK6	0.0	784	479	0.780	0.762	AL3B3_MOUSE Aldehyde dehydrogenase family 3 member B3 OS=Mus musculus OX=10090 GN=Aldh3b3 PE=1 SV=1
3	P11883	0.0	523	453	0.519	0.536	AL3A1_RAT Aldehyde dehydrogenase, dimeric NADP-preferring OS=Rattus norvegicus OX=10116 GN=Aldh3a1 PE=1 SV=3
4	P30838	0.0	518	453	0.517	0.534	AL3A1_HUMAN Aldehyde dehydrogenase, dimeric NADP-preferring OS=Homo sapiens OX=9606 GN=ALDH3A1 PE=1 SV=3
5	P43353	0.0	968	468	1.000	1.000	AL3B1_HUMAN Aldehyde dehydrogenase family 3 member B1 OS=Homo sapiens OX=9606 GN=ALDH3B1 PE=1 SV=1
6	P47739	0.0	517	453	0.511	0.528	AL3A1_MOUSE Aldehyde dehydrogenase, dimeric NADP-preferring OS=Mus musculus OX=10090 GN=Aldh3a1 PE=1 SV=2
7	P48448	0.0	661	385	0.684	0.831	AL3B2_HUMAN Aldehyde dehydrogenase family 3 member B2 OS=Homo sapiens OX=9606 GN=ALDH3B2 PE=2 SV=3
8	P51648	0.0	528	485	0.524	0.505	AL3A2_HUMAN Aldehyde dehydrogenase family 3 member A2 OS=Homo sapiens OX=9606 GN=ALDH3A2 PE=1 SV=1
9	Q80VQ0	0.0	828	468	0.838	0.838	AL3B1_MOUSE Aldehyde dehydrogenase family 3 member B1 OS=Mus musculus OX=10090 GN=Aldh3b1 PE=1 SV=1
10	P47740	9.51e-175	501	484	0.519	0.502	AL3A2_MOUSE Aldehyde dehydrogenase family 3 member A2 OS=Mus musculus OX=10090 GN=Aldh3a2 PE=1 SV=2
11	Q99PH4	9.81e-174	499	507	0.519	0.479	Q99PH4_MOUSE Aldehyde dehydrogenase OS=Mus musculus OX=10090 GN=Aldh3a2 PE=3 SV=1
12	P30839	1.73e-173	498	484	0.513	0.496	AL3A2_RAT Aldehyde dehydrogenase family 3 member A2 OS=Rattus norvegicus OX=10116 GN=Aldh3a2 PE=1 SV=1
13	I3L3I9	2.42e-160	460	380	0.453	0.558	I3L3I9_HUMAN Aldehyde dehydrogenase 3 family member A1 OS=Homo sapiens OX=9606 GN=ALDH3A1 PE=1 SV=1
14	Q2FWX9	6.95e-138	406	459	0.415	0.423	DIALD_STAA8 4,4'-diaponeurosporen-aldehyde dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=aldH1 PE=1 SV=1
15	Q70DU8	5.42e-131	389	484	0.421	0.407	AL3H1_ARATH Aldehyde dehydrogenase family 3 member H1 OS=Arabidopsis thaliana OX=3702 GN=ALDH3H1 PE=1 SV=2
16	Q54DG1	4.33e-130	386	470	0.427	0.426	ALDH3_DICDI Aldehyde dehydrogenase family 3 comG OS=Dictyostelium discoideum OX=44689 GN=comG PE=3 SV=1
17	Q8W033	1.82e-124	375	550	0.406	0.345	AL3I1_ARATH Aldehyde dehydrogenase family 3 member I1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ALDH3I1 PE=1 SV=2
18	Q70E96	9.65e-124	371	484	0.423	0.409	AL3F1_ARATH Aldehyde dehydrogenase family 3 member F1 OS=Arabidopsis thaliana OX=3702 GN=ALDH3F1 PE=2 SV=2
19	Q583M9	5.71e-115	350	543	0.412	0.355	Q583M9_TRYB2 Aldehyde dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.780 PE=1 SV=1
20	P96824	7.95e-115	348	506	0.404	0.374	P96824_MYCTU Aldehyde dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0147 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00171 Aldedh	4.3e-82	287.7	Aldehyde dehydrogenase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000473990

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253382	0.938	Acetyl-coenzyme A synthetase, cytoplasmic
2	9606.ENSP00000440689	0.938	Cytochrome P450 2E1
3	9606.ENSP00000340684	0.933	Amine oxidase [flavin-containing] A
4	9606.ENSP00000255084	0.930	Aldehyde dehydrogenase family 3 member B2
5	9606.ENSP00000316924	0.930	Acetyl-coenzyme A synthetase 2-like, mitochondrial
6	9606.ENSP00000361140	0.930	Alcohol dehydrogenase [NADP(+)]
7	9606.ENSP00000379845	0.929	4-aminobutyrate aminotransferase, mitochondrial
8	9606.ENSP00000367309	0.927	Amine oxidase [flavin-containing] B
9	9606.ENSP00000354511	0.921	Catechol O-methyltransferase
10	9606.ENSP00000305742	0.919	Transmembrane O-methyltransferase
11	9606.ENSP00000416583	0.916	Deoxyribose-phosphate aldolase
12	9606.ENSP00000324343	0.912	Beta-ureidopropionase
13	9606.ENSP00000312326	0.910	Membrane primary amine oxidase
14	9606.ENSP00000253799	0.909	Retina-specific copper amine oxidase
15	9606.ENSP00000282538	0.908	Acidic amino acid decarboxylase GADL1
16	9606.ENSP00000350928	0.908	Glutamate decarboxylase 1
17	9606.ENSP00000365437	0.908	Glutamate decarboxylase 2
18	9606.ENSP00000325548	0.905	Cytosolic non-specific dipeptidase
19	9606.ENSP00000389009	0.905	Carnosine synthase 1
20	9606.ENSP00000351682	0.904	Carnosine dipeptidase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004030	1.000	aldehyde dehydrogenase [NAD(P)+] activity
GO:0005515	0.998	protein binding
GO:0004029	0.972	aldehyde dehydrogenase (NAD+) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0006081	0.993	cellular aldehyde metabolic process
GO:0044238	0.896	primary metabolic process
GO:0044281	0.803	small molecule metabolic process
GO:0006807	0.648	nitrogen compound metabolic process
GO:0050896	0.487	response to stimulus
GO:1901564	0.464	organonitrogen compound metabolic process
GO:0006629	0.420	lipid metabolic process
GO:0042221	0.358	response to chemical
GO:0009056	0.353	catabolic process
GO:0009058	0.348	biosynthetic process
GO:1901615	0.332	organic hydroxy compound metabolic process
GO:0044248	0.306	cellular catabolic process
GO:0044249	0.304	cellular biosynthetic process
GO:1901576	0.300	organic substance biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.991	membrane
GO:0043227	0.976	membrane-bounded organelle
GO:0043229	0.972	intracellular organelle
GO:0005576	0.965	extracellular region
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0031982	0.958	vesicle
GO:0005829	0.955	cytosol
GO:0005886	0.949	plasma membrane
GO:0065010	0.907	extracellular membrane-bounded organelle
GO:0070062	0.897	extracellular exosome
GO:0031090	0.829	organelle membrane
GO:0012505	0.703	endomembrane system
GO:0070013	0.448	intracellular organelle lumen
GO:0031410	0.355	cytoplasmic vesicle
GO:0005634	0.309	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.1.5	1.000	aldehyde dehydrogenase [NAD(P)(+)].
RHEA:16185	0.972	an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH
EC:1.2.1.3	0.972	aldehyde dehydrogenase (NAD(+)).

[back to server]