StarFunc result for job id P43354

User Input

>input (598 residues)
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSV
YYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQ
SPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHA
SQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSP
PVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW
AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVT
FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1D8N6	0.542	0.542	6.016E-69	598	1.000	1.000	F1D8N6.pdb.gz	F1D8N6_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
2	AFDB:P51179	0.409	0.390	8.542E-44	628	0.590	0.562	P51179.pdb.gz	NR4A3_RAT Nuclear receptor subfamily 4 group A member 3 OS=Rattus norvegicus OX=10116 GN=Nr4a3 PE=1 SV=1
3	AFDB:F8W6I3	0.205	0.216	1.206E-41	553	0.768	0.830	F8W6I3.pdb.gz	F8W6I3_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
4	AFDB:Q90416	0.336	0.449	6.320E-21	441	0.212	0.288	Q90416.pdb.gz	RXRGA_DANRE Retinoic acid receptor RXR-gamma-A OS=Danio rerio OX=7955 GN=rxrga PE=2 SV=2
5	AFDB:Q7SYN5	0.331	0.410	1.765E-19	471	0.231	0.293	Q7SYN5.pdb.gz	RXRBA_DANRE Retinoic acid receptor RXR-beta-A OS=Danio rerio OX=7955 GN=rxrba PE=2 SV=1
6	AFDB:P34021	0.352	0.246	2.340E-18	878	0.217	0.148	P34021.pdb.gz	ECR_DROME Ecdysone receptor OS=Drosophila melanogaster OX=7227 GN=EcR PE=1 SV=1
7	PDB:3dzyA	0.309	0.593	1.751E-16	302	0.169	0.334	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
8	AFDB:P13055	0.307	0.138	6.960E-16	1412	0.253	0.107	P13055.pdb.gz	E75BB_DROME Ecdysone-induced protein 75B, isoform B OS=Drosophila melanogaster OX=7227 GN=Eip75B PE=2 SV=2
9	AFDB:Q9GLW0	0.364	0.251	4.015E-15	939	0.207	0.132	Q9GLW0.pdb.gz	PRGR_CANLF Progesterone receptor OS=Canis lupus familiaris OX=9615 GN=PGR PE=2 SV=1
10	AFDB:P06401	0.389	0.265	3.288E-14	933	0.202	0.130	P06401.pdb.gz	PRGR_HUMAN Progesterone receptor OS=Homo sapiens OX=9606 GN=PGR PE=1 SV=4
11	AFDB:Q6RKQ3	0.373	0.340	4.467E-14	669	0.181	0.161	Q6RKQ3.pdb.gz	Q6RKQ3_ONCMY Glucocorticoid receptor OS=Oncorhynchus mykiss OX=8022 GN=nr3c1 PE=2 SV=1
12	PDB:6fx0A	0.350	0.842	1.810E-12	238	0.099	0.248	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.310	0.715	2.885E-6	246	0.087	0.211	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.284	0.603	6.348E-6	259	0.067	0.154	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:1h2sA	0.089	0.180	3.786E-1	225	0.040	0.107	1h2sA.pdb.gz	Molecular Basis of Transmembrane Signalling by Sensory Rhodopsin II-Transducer Complex
16	PDB:7qp9A	0.086	0.122	4.713E-1	327	0.067	0.122	7qp9A.pdb.gz	Structures and mechanism of the plant PIN-FORMED auxin transporter.
17	PDB:1x8zA	0.087	0.205	6.130E-1	151	0.035	0.139	1x8zA.pdb.gz
18	PDB:7ocaI	0.074	0.179	8.702E-1	185	0.035	0.114	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
19	PDB:1smsA	0.089	0.128	9.499E-1	314	0.054	0.102	1smsA.pdb.gz
20	PDB:6ch3B	0.058	0.183	1.083	162	0.042	0.154	6ch3B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R9YJF7	0.0	1019	598	0.875	0.875	A0A2R9YJF7_DANRE Nuclear receptor subfamily 4 group A member 2 OS=Danio rerio OX=7955 GN=nr4a2a PE=3 SV=1
2	A9Q8C8	0.0	1020	598	0.876	0.876	A9Q8C8_DANRE Nuclear receptor subfamily 4 group A member 2 OS=Danio rerio OX=7955 GN=nr4a2a PE=2 SV=1
3	C9IYM5	0.0	530	258	0.431	1.000	C9IYM5_HUMAN Nuclear receptor subfamily 4 group A member 2 (Fragment) OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
4	F1D8N6	0.0	1245	598	1.000	1.000	F1D8N6_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
5	F5GXF0	0.0	590	652	0.554	0.508	F5GXF0_HUMAN Nuclear receptor subfamily 4 group A member 1 OS=Homo sapiens OX=9606 GN=NR4A1 PE=1 SV=1
6	F8W6I3	0.0	955	553	0.779	0.843	F8W6I3_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
7	P12813	0.0	570	601	0.530	0.527	NR4A1_MOUSE Nuclear receptor subfamily 4 group A member 1 OS=Mus musculus OX=10090 GN=Nr4a1 PE=1 SV=1
8	P22736	0.0	590	598	0.554	0.554	NR4A1_HUMAN Nuclear receptor subfamily 4immunitygroup A member 1 OS=Homo sapiens OX=9606 GN=NR4A1 PE=1 SV=1
9	P22829	0.0	561	597	0.535	0.536	NR4A1_RAT Nuclear receptor subfamily 4 group A member 1 OS=Rattus norvegicus OX=10116 GN=Nr4a1 PE=1 SV=2
10	P43354	0.0	1245	598	1.000	1.000	NR4A2_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
11	P51179	0.0	590	628	0.590	0.562	NR4A3_RAT Nuclear receptor subfamily 4 group A member 3 OS=Rattus norvegicus OX=10116 GN=Nr4a3 PE=1 SV=1
12	Q06219	0.0	1240	598	0.995	0.995	NR4A2_MOUSE Nuclear receptor subfamily 4 group A member 2 OS=Mus musculus OX=10090 GN=Nr4a2 PE=1 SV=1
13	Q07917	0.0	1240	598	0.995	0.995	NR4A2_RAT Nuclear receptor subfamily 4 group A member 2 OS=Rattus norvegicus OX=10116 GN=Nr4a2 PE=1 SV=3
14	Q6DH08	0.0	860	586	0.722	0.737	Q6DH08_DANRE Nuclear receptor subfamily 4 group A member 2 OS=Danio rerio OX=7955 GN=nurr1 PE=2 SV=1
15	Q92570	0.0	593	626	0.599	0.572	NR4A3_HUMAN Nuclear receptor subfamily 4 group A member 3 OS=Homo sapiens OX=9606 GN=NR4A3 PE=1 SV=3
16	Q9QZB6	0.0	591	627	0.590	0.563	NR4A3_MOUSE Nuclear receptor subfamily 4 group A member 3 OS=Mus musculus OX=10090 GN=Nr4a3 PE=1 SV=1
17	F1R8N1	1.69e-175	512	594	0.550	0.554	F1R8N1_DANRE Nuclear receptor subfamily 4 group A member 2 OS=Danio rerio OX=7955 GN=NOR1 PE=3 SV=1
18	P49869	3.09e-154	472	1073	0.385	0.214	HR38_DROME Probable nuclear hormone receptor HR38 OS=Drosophila melanogaster OX=7227 GN=Hr38 PE=1 SV=3
19	P22448	6.10e-59	205	455	0.184	0.242	RARB_CHICK Retinoic acid receptor beta OS=Gallus gallus OX=9031 GN=RARB PE=2 SV=2
20	A0A8I6A7Z0	2.15e-57	201	455	0.182	0.240	A0A8I6A7Z0_RAT Retinoic acid receptor, beta OS=Rattus norvegicus OX=10116 GN=Rarb PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	5.5e-27	106.3	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	8.8e-28	107.9	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 72004.XP_005906445.1

Rank	PPI partner	STRING score	Description
1	72004.XP_005900385.1	0.791	FosB proto-oncogene, AP-1 transcription factor subunit
2	72004.XP_005890251.1	0.782	Retinoic acid receptor RXR-gamma isoform X1
3	72004.XP_005903992.1	0.777	REST corepressor 1
4	72004.XP_005897506.1	0.771	Retinoic acid receptor RXR-alpha
5	72004.XP_005891450.1	0.767	Retinoid X receptor beta
6	72004.XP_005904712.1	0.767	Nuclear receptor corepressor 2
7	72004.XP_005894200.1	0.758	REST corepressor 2
8	72004.XP_005896303.1	0.735	Lymphoid enhancer-binding factor 1 isoform X1
9	72004.XP_005888180.1	0.714	Paired like homeodomain 3
10	72004.XP_005891129.1	0.696	Catenin beta-1
11	72004.XP_005890250.1	0.691	LIM homeobox transcription factor 1-alpha
12	72004.XP_005889086.1	0.686	Forkhead box A2
13	72004.XP_005887319.1	0.663	Nuclear receptor corepressor 1 isoform X1
14	72004.XP_005903569.1	0.646	Tyrosine 3-monooxygenase
15	72004.XP_005896019.1	0.632	Protein inhibitor of activated STAT 4
16	72004.XP_005902822.1	0.623	netrin-G2
17	72004.XP_005899812.1	0.620	Nuclear receptor subfamily 0 group B member 1
18	72004.XP_005901389.1	0.615	CREB-binding protein
19	72004.XP_005909489.1	0.615	E1A binding protein p300
20	72004.XP_005886931.1	0.613	Belongs to the ubiquitin-conjugating enzyme family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0016922	0.998	nuclear receptor binding
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0001067	0.925	transcription regulatory region nucleic acid binding
GO:0000976	0.893	transcription cis-regulatory region binding
GO:0001216	0.845	DNA-binding transcription activator activity
GO:0060089	0.829	molecular transducer activity
GO:0000987	0.785	cis-regulatory region sequence-specific DNA binding
GO:0001228	0.698	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0038023	0.617	signaling receptor activity
GO:0098531	0.579	ligand-activated transcription factor activity
GO:0000977	0.527	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.462	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0004879	0.456	nuclear receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.989	regulation of biological process
GO:0007275	0.986	multicellular organism development
GO:0050794	0.984	regulation of cellular process
GO:0019222	0.984	regulation of metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0030154	0.974	cell differentiation
GO:0007399	0.971	nervous system development
GO:0060322	0.966	head development
GO:0010468	0.948	regulation of gene expression
GO:0080090	0.940	regulation of primary metabolic process
GO:0031323	0.940	regulation of cellular metabolic process
GO:0051171	0.939	regulation of nitrogen compound metabolic process
GO:0048518	0.930	positive regulation of biological process
GO:0009889	0.925	regulation of biosynthetic process
GO:0010556	0.922	regulation of macromolecule biosynthetic process
GO:0019219	0.921	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.917	regulation of cellular biosynthetic process
GO:0048699	0.911	generation of neurons
GO:2001141	0.906	regulation of RNA biosynthetic process
GO:0006355	0.903	regulation of DNA-templated transcription
GO:0048522	0.881	positive regulation of cellular process
GO:0007417	0.866	central nervous system development
GO:0048513	0.853	animal organ development
GO:0050896	0.845	response to stimulus
GO:0010604	0.837	positive regulation of macromolecule metabolic process
GO:0007420	0.805	brain development
GO:0051173	0.766	positive regulation of nitrogen compound metabolic process
GO:0031325	0.752	positive regulation of cellular metabolic process
GO:0030900	0.735	forebrain development
GO:0048519	0.699	negative regulation of biological process
GO:0048523	0.685	negative regulation of cellular process
GO:0006357	0.667	regulation of transcription by RNA polymerase II
GO:0045935	0.627	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.617	positive regulation of RNA metabolic process
GO:0009891	0.596	positive regulation of biosynthetic process
GO:0031328	0.594	positive regulation of cellular biosynthetic process
GO:0010557	0.589	positive regulation of macromolecule biosynthetic process
GO:0045893	0.576	positive regulation of DNA-templated transcription
GO:0045944	0.557	positive regulation of transcription by RNA polymerase II
GO:0071704	0.474	organic substance metabolic process
GO:0051716	0.421	cellular response to stimulus
GO:0010605	0.409	negative regulation of macromolecule metabolic process
GO:0007154	0.404	cell communication
GO:0051172	0.404	negative regulation of nitrogen compound metabolic process
GO:0023052	0.400	signaling
GO:0031324	0.382	negative regulation of cellular metabolic process
GO:0042221	0.374	response to chemical
GO:0044237	0.371	cellular metabolic process
GO:0030182	0.338	neuron differentiation
GO:0045934	0.313	negative regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.864	cytoplasm
GO:0032991	0.759	protein-containing complex
GO:0016604	0.559	nuclear body
GO:0016607	0.352	nuclear speck
GO:0043232	0.329	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]