StarFunc result for job id P43355

User Input

>input (309 residues)
MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQG
ASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAR
EPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYD
GLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLT
QDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREA
ALREEEEGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43355	1.000	1.000	2.480E-54	309	1.000	1.000	P43355.pdb.gz	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
2	AFDB:P43358	0.703	0.686	3.054E-40	317	0.770	0.751	P43358.pdb.gz	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
3	AFDB:P43357	0.645	0.635	2.699E-36	314	0.673	0.662	P43357.pdb.gz	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
4	AFDB:P43365	0.678	0.668	9.991E-35	314	0.673	0.662	P43365.pdb.gz	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
5	AFDB:P43356	0.637	0.627	2.851E-34	314	0.676	0.666	P43356.pdb.gz	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
6	AFDB:P43362	0.675	0.663	9.106E-32	315	0.608	0.597	P43362.pdb.gz	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
7	AFDB:P43364	0.627	0.453	1.942E-31	429	0.612	0.441	P43364.pdb.gz	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
8	AFDB:P43363	0.615	0.516	7.387E-29	369	0.560	0.469	P43363.pdb.gz	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
9	AFDB:O15480	0.582	0.521	1.201E-23	346	0.437	0.390	O15480.pdb.gz	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
10	AFDB:O15481	0.352	0.316	1.806E-23	346	0.430	0.384	O15481.pdb.gz	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
11	PDB:7qcdE	0.297	0.347	4.337E-5	261	0.120	0.142	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
12	PDB:7tveF	0.269	0.303	2.216E-4	270	0.110	0.126	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
13	PDB:5hs7A	0.192	0.490	2.629E-2	102	0.055	0.167	5hs7A.pdb.gz
14	PDB:7d58O	0.216	0.151	2.629E-2	490	0.110	0.069	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
15	PDB:4zzlA	0.215	0.408	4.442E-2	146	0.045	0.096	4zzlA.pdb.gz
16	PDB:1z9cC	0.211	0.411	5.943E-2	138	0.042	0.094	1z9cC.pdb.gz	Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.
17	PDB:6f40P	0.163	0.196	5.943E-2	246	0.091	0.114	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
18	PDB:1ldjA	0.158	0.075	1.004E-1	725	0.068	0.029	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
19	PDB:3cuqA	0.176	0.234	1.004E-1	219	0.100	0.142	3cuqA.pdb.gz
20	PDB:5h3rA	0.202	0.385	1.267E-1	141	0.039	0.085	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43355	0.0	629	309	1.000	1.000	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
2	Q1RN33	2.67e-162	456	317	0.773	0.754	Q1RN33_HUMAN Melanoma antigen A 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=1
3	P43358	1.37e-161	454	317	0.770	0.751	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
4	P43357	9.49e-142	404	314	0.680	0.669	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
5	P43365	4.76e-140	400	314	0.680	0.669	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
6	P43360	1.58e-138	396	314	0.689	0.678	MAGA6_HUMAN Melanoma-associated antigen 6 OS=Homo sapiens OX=9606 GN=MAGEA6 PE=1 SV=1
7	P43361	6.76e-135	387	318	0.686	0.667	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
8	Q96E03	9.52e-135	386	314	0.683	0.672	Q96E03_HUMAN Melanoma antigen family A, 2B OS=Homo sapiens OX=9606 GN=MAGEA2B PE=1 SV=1
9	P43356	7.77e-134	384	314	0.680	0.669	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
10	G5E962	3.20e-117	345	400	0.615	0.475	G5E962_HUMAN MAGE family member A11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=1
11	P43364	9.06e-117	345	429	0.615	0.443	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
12	P43362	3.13e-112	329	315	0.615	0.603	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
13	P43363	3.69e-102	305	369	0.557	0.466	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
14	O15480	7.70e-77	240	346	0.424	0.379	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
15	Q96M61	1.34e-75	237	343	0.440	0.397	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
16	O15481	3.25e-75	236	346	0.427	0.382	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
17	Q8BQR7	2.88e-67	215	327	0.385	0.364	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1
18	Q96LZ2	5.33e-67	215	347	0.372	0.331	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
19	C9J2X2	1.35e-66	212	295	0.395	0.414	C9J2X2_HUMAN MAGE family member A11 (Fragment) OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
20	O15479	4.24e-65	209	319	0.330	0.320	MAGB2_HUMAN Melanoma-associated antigen B2 OS=Homo sapiens OX=9606 GN=MAGEB2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01454 MAGE	1.1e-14	66.2	MAGE homology domain
2	PF12440 MAGE_N	4e-13	61.2	Melanoma associated antigen family N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349085

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355421	0.909	G antigen 2A
2	9606.ENSP00000485185	0.909	Unknown. Candidate gene encoding tumor antigens
3	9606.ENSP00000261531	0.899	SNW domain-containing protein 1
4	9606.ENSP00000404123	0.897	G antigen 12F
5	9606.ENSP00000332602	0.864	Cancer/testis antigen 1B
6	9606.ENSP00000469441	0.864	Cancer/testis antigen 1A
7	9606.ENSP00000484668	0.852	G antigen 1
8	9606.ENSP00000435619	0.850	EP300-interacting inhibitor of differentiation 3
9	9606.ENSP00000358019	0.768	Non-structural maintenance of chromosomes element 4 homolog A
10	9606.ENSP00000359310	0.768	Putative chondrosarcoma-associated gene 1 protein
11	9606.ENSP00000402758	0.765	Melanocyte protein PMEL
12	9606.ENSP00000359361	0.764	Probable ATP-dependent RNA helicase DDX43
13	9606.ENSP00000247306	0.762	Belongs to the CTAG/PCC1 family
14	9606.ENSP00000483811	0.739	G antigen 13
15	9606.ENSP00000445675	0.735	Melanoma antigen preferentially expressed in tumors
16	9606.ENSP00000355077	0.732	Non-structural maintenance of chromosomes element 1 homolog
17	9606.ENSP00000416249	0.723	G antigen 12G
18	9606.ENSP00000338796	0.718	Synovial sarcoma, X breakpoint 2
19	9606.ENSP00000263321	0.717	Tyrosinase
20	9606.ENSP00000469011	0.688	Synovial sarcoma, X breakpoint 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.305	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0019222	0.971	regulation of metabolic process
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0048523	0.957	negative regulation of cellular process
GO:0051171	0.946	regulation of nitrogen compound metabolic process
GO:0080090	0.945	regulation of primary metabolic process
GO:0031323	0.906	regulation of cellular metabolic process
GO:0010468	0.902	regulation of gene expression
GO:0009892	0.866	negative regulation of metabolic process
GO:0031324	0.863	negative regulation of cellular metabolic process
GO:0010605	0.845	negative regulation of macromolecule metabolic process
GO:0048583	0.842	regulation of response to stimulus
GO:0051172	0.839	negative regulation of nitrogen compound metabolic process
GO:0048518	0.803	positive regulation of biological process
GO:0009966	0.800	regulation of signal transduction
GO:0019219	0.622	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.617	cellular process
GO:0010556	0.606	regulation of macromolecule biosynthetic process
GO:1903506	0.597	regulation of nucleic acid-templated transcription
GO:0008593	0.579	regulation of Notch signaling pathway
GO:0045934	0.578	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.559	negative regulation of biosynthetic process
GO:0048522	0.543	positive regulation of cellular process
GO:0048585	0.531	negative regulation of response to stimulus
GO:0006355	0.530	regulation of DNA-templated transcription
GO:1902679	0.514	negative regulation of RNA biosynthetic process
GO:0071704	0.504	organic substance metabolic process
GO:0006807	0.473	nitrogen compound metabolic process
GO:0044238	0.438	primary metabolic process
GO:1903507	0.438	negative regulation of nucleic acid-templated transcription
GO:0045892	0.414	negative regulation of DNA-templated transcription
GO:0050896	0.374	response to stimulus
GO:0043170	0.358	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0016020	0.970	membrane
GO:0005886	0.928	plasma membrane
GO:0005829	0.819	cytosol
GO:0016604	0.485	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]