StarFunc result for job id P43356

User Input

>input (314 residues)
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQQTASSSSTLVEVTLGEVPAADSPS
PPHSPQGASSFSTTINYTLWRQSDEGSSNQEEEGPRMFPDLESEFQAAISRKMVELVHFL
LLKYRAREPVTKAEMLESVLRNCQDFFPVIFSKASEYLQLVFGIEVVEVVPISHLYILVT
CLGLSYDGLLGDNQVMPKTGLLIIVLAIIAIEGDCAPEEKIWEELSMLEVFEGREDSVFA
HPRKLLMQDLVQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHTLKIGGEPHIS
YPPLHERALREGEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43356	1.000	1.000	1.694E-53	314	1.000	1.000	P43356.pdb.gz	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
2	AFDB:P43365	0.703	0.703	7.315E-44	314	0.882	0.882	P43365.pdb.gz	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
3	AFDB:P43357	0.708	0.708	1.527E-42	314	0.844	0.844	P43357.pdb.gz	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
4	AFDB:P43358	0.662	0.657	1.136E-35	317	0.675	0.669	P43358.pdb.gz	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
5	AFDB:P43361	0.609	0.601	1.588E-34	318	0.634	0.626	P43361.pdb.gz	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
6	AFDB:P43355	0.626	0.636	3.974E-34	309	0.666	0.676	P43355.pdb.gz	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
7	AFDB:P43364	0.640	0.473	1.024E-30	429	0.583	0.427	P43364.pdb.gz	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
8	AFDB:P43362	0.613	0.611	9.043E-30	315	0.592	0.590	P43362.pdb.gz	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
9	AFDB:P43363	0.632	0.541	2.352E-27	369	0.525	0.447	P43363.pdb.gz	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
10	AFDB:Q96M61	0.591	0.544	2.223E-21	343	0.366	0.335	Q96M61.pdb.gz	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
11	PDB:7tveF	0.291	0.332	9.190E-5	270	0.105	0.122	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
12	PDB:7qcdE	0.303	0.358	3.063E-4	261	0.118	0.142	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
13	PDB:7a6hO	0.175	0.122	1.201E-2	512	0.089	0.055	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
14	PDB:7d58O	0.202	0.145	1.694E-2	490	0.092	0.059	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
15	PDB:7z1mO	0.165	0.113	2.012E-2	570	0.086	0.047	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
16	PDB:5h3rA	0.205	0.401	2.680E-2	141	0.057	0.128	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
17	PDB:4zzlA	0.212	0.412	3.183E-2	146	0.048	0.103	4zzlA.pdb.gz
18	PDB:3cuqA	0.189	0.259	3.570E-2	219	0.096	0.137	3cuqA.pdb.gz
19	PDB:5hs7A	0.195	0.499	3.781E-2	102	0.057	0.176	5hs7A.pdb.gz
20	PDB:6hivBN	0.221	0.307	5.333E-2	214	0.045	0.065	6hivBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43356	0.0	640	314	1.000	1.000	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
2	P43357	0.0	537	314	0.844	0.844	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
3	P43360	0.0	515	314	0.838	0.838	MAGA6_HUMAN Melanoma-associated antigen 6 OS=Homo sapiens OX=9606 GN=MAGEA6 PE=1 SV=1
4	P43365	0.0	566	314	0.882	0.882	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
5	Q96E03	0.0	638	314	0.997	0.997	Q96E03_HUMAN Melanoma antigen family A, 2B OS=Homo sapiens OX=9606 GN=MAGEA2B PE=1 SV=1
6	Q1RN33	1.34e-146	416	317	0.659	0.653	Q1RN33_HUMAN Melanoma antigen A 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=1
7	P43358	1.76e-146	416	317	0.659	0.653	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
8	P43355	2.54e-128	370	309	0.643	0.654	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
9	P43361	3.86e-128	370	318	0.637	0.629	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
10	G5E962	7.24e-119	349	400	0.583	0.458	G5E962_HUMAN MAGE family member A11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=1
11	P43364	2.03e-118	349	429	0.583	0.427	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
12	P43362	1.81e-109	322	315	0.596	0.594	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
13	P43363	1.42e-99	299	369	0.532	0.453	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
14	C9J2X2	2.15e-72	227	295	0.395	0.420	C9J2X2_HUMAN MAGE family member A11 (Fragment) OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
15	Q96M61	5.82e-70	223	343	0.401	0.367	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
16	O15481	2.75e-69	221	346	0.411	0.373	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
17	O15480	1.03e-65	211	346	0.373	0.338	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
18	Q96LZ2	3.37e-63	205	347	0.331	0.300	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
19	Q8BQR7	2.10e-61	200	327	0.350	0.336	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1
20	Q9UBF1	2.90e-57	191	373	0.322	0.271	MAGC2_HUMAN Melanoma-associated antigen C2 OS=Homo sapiens OX=9606 GN=MAGEC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01454 MAGE	2.1e-16	71.8	MAGE homology domain
2	PF12440 MAGE_N	1.1e-23	95.0	Melanoma associated antigen family N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485541

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253024	0.822	Transcription intermediary factor 1-beta
2	9606.ENSP00000359310	0.802	Putative chondrosarcoma-associated gene 1 protein
3	9606.ENSP00000269305	0.781	Cellular tumor antigen p53
4	9606.ENSP00000473093	0.774	Melanoma-associated antigen 3
5	9606.ENSP00000333487	0.731	Melanoma antigen family A, 2B
6	9606.ENSP00000484668	0.720	G antigen 1
7	9606.ENSP00000355421	0.702	G antigen 2A
8	9606.ENSP00000347836	0.699	Ubiquitin-conjugating enzyme E2 H
9	9606.ENSP00000377478	0.679	Melanoma-associated antigen 12
10	9606.ENSP00000404123	0.662	G antigen 12F
11	9606.ENSP00000480637	0.661	Melanoma-associated antigen 6
12	9606.ENSP00000478568	0.651	G antigen 2E
13	9606.ENSP00000469441	0.650	Cancer/testis antigen 1A
14	9606.ENSP00000332602	0.647	Cancer/testis antigen 1B
15	9606.ENSP00000247306	0.636	Belongs to the CTAG/PCC1 family
16	9606.ENSP00000445675	0.629	Melanoma antigen preferentially expressed in tumors
17	9606.ENSP00000485185	0.612	Unknown. Candidate gene encoding tumor antigens
18	9606.ENSP00000416249	0.585	G antigen 12G
19	9606.ENSP00000351884	0.555	Sperm protein associated with the nucleus on the X chromosome C
20	9606.ENSP00000338796	0.552	Synovial sarcoma, X breakpoint 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048523	0.985	negative regulation of cellular process
GO:0071704	0.961	organic substance metabolic process
GO:0031323	0.958	regulation of cellular metabolic process
GO:0010605	0.907	negative regulation of macromolecule metabolic process
GO:0051172	0.906	negative regulation of nitrogen compound metabolic process
GO:0031324	0.903	negative regulation of cellular metabolic process
GO:0010468	0.871	regulation of gene expression
GO:0009987	0.862	cellular process
GO:0080090	0.857	regulation of primary metabolic process
GO:0010507	0.857	negative regulation of autophagy
GO:0065009	0.849	regulation of molecular function
GO:0051246	0.831	regulation of protein metabolic process
GO:0050790	0.801	regulation of catalytic activity
GO:0048518	0.799	positive regulation of biological process
GO:0009890	0.771	negative regulation of biosynthetic process
GO:0031326	0.769	regulation of cellular biosynthetic process
GO:0006355	0.762	regulation of DNA-templated transcription
GO:0044238	0.692	primary metabolic process
GO:0051253	0.692	negative regulation of RNA metabolic process
GO:0031398	0.660	positive regulation of protein ubiquitination
GO:0006807	0.659	nitrogen compound metabolic process
GO:0044237	0.616	cellular metabolic process
GO:1903507	0.594	negative regulation of nucleic acid-templated transcription
GO:0051338	0.581	regulation of transferase activity
GO:0050896	0.569	response to stimulus
GO:0043170	0.513	macromolecule metabolic process
GO:0045892	0.493	negative regulation of DNA-templated transcription
GO:0051248	0.485	negative regulation of protein metabolic process
GO:1901564	0.457	organonitrogen compound metabolic process
GO:0009056	0.450	catabolic process
GO:0048583	0.445	regulation of response to stimulus
GO:0010941	0.440	regulation of cell death
GO:0043067	0.428	regulation of programmed cell death
GO:0048522	0.410	positive regulation of cellular process
GO:0006357	0.357	regulation of transcription by RNA polymerase II
GO:0043066	0.341	negative regulation of apoptotic process
GO:0090398	0.335	cellular senescence

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.998	cytoplasm
GO:0012505	0.931	endomembrane system
GO:0016604	0.815	nuclear body
GO:0016020	0.702	membrane
GO:0005829	0.694	cytosol
GO:0016605	0.650	PML body
GO:0071944	0.357	cell periphery
GO:0005886	0.322	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]