StarFunc result for job id P43357

User Input

>input (314 residues)
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPD
PPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFL
LLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFAT
CLGLSYDGLLGDNQIMPKAGLLIIVLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILG
DPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHMVKISGGPHIS
YPPLHEWVLREGEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43357	1.000	1.000	2.080E-52	314	1.000	1.000	P43357.pdb.gz	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
2	AFDB:P43365	0.632	0.632	4.799E-44	314	0.854	0.854	P43365.pdb.gz	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
3	AFDB:P43356	0.708	0.708	2.420E-42	314	0.844	0.844	P43356.pdb.gz	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
4	AFDB:P43355	0.635	0.645	1.107E-35	309	0.662	0.673	P43355.pdb.gz	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
5	AFDB:P43358	0.621	0.615	3.310E-35	317	0.682	0.675	P43358.pdb.gz	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
6	AFDB:P43361	0.609	0.602	1.181E-33	318	0.634	0.626	P43361.pdb.gz	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
7	AFDB:P43364	0.609	0.450	5.306E-32	429	0.599	0.438	P43364.pdb.gz	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
8	AFDB:P43363	0.599	0.512	6.779E-28	369	0.506	0.431	P43363.pdb.gz	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
9	AFDB:O15480	0.573	0.522	4.901E-22	346	0.357	0.324	O15480.pdb.gz	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
10	AFDB:Q96M61	0.561	0.517	1.098E-21	343	0.363	0.332	Q96M61.pdb.gz	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
11	PDB:7qcdE	0.291	0.343	1.895E-5	261	0.137	0.165	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
12	PDB:7tveF	0.281	0.322	5.049E-5	270	0.111	0.130	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
13	PDB:5h3rA	0.209	0.403	9.050E-3	141	0.045	0.099	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
14	PDB:3cuqA	0.173	0.233	1.355E-2	219	0.092	0.132	3cuqA.pdb.gz
15	PDB:1z9cC	0.210	0.413	1.521E-2	138	0.038	0.087	1z9cC.pdb.gz	Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.
16	PDB:6f40P	0.161	0.196	1.521E-2	246	0.105	0.134	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
17	PDB:4zzlA	0.208	0.398	1.808E-2	146	0.041	0.089	4zzlA.pdb.gz
18	PDB:6hivBN	0.225	0.315	2.277E-2	214	0.038	0.056	6hivBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:6hixBN	0.225	0.315	2.867E-2	214	0.035	0.051	6hixBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:7d58O	0.221	0.154	3.217E-2	490	0.096	0.061	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43356	0.0	515	314	0.844	0.844	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
2	P43357	0.0	637	314	1.000	1.000	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
3	P43360	0.0	598	314	0.959	0.959	MAGA6_HUMAN Melanoma-associated antigen 6 OS=Homo sapiens OX=9606 GN=MAGEA6 PE=1 SV=1
4	P43365	0.0	548	314	0.854	0.854	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
5	Q96E03	0.0	518	314	0.847	0.847	Q96E03_HUMAN Melanoma antigen family A, 2B OS=Homo sapiens OX=9606 GN=MAGEA2B PE=1 SV=1
6	Q1RN33	1.04e-146	417	317	0.669	0.662	Q1RN33_HUMAN Melanoma antigen A 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=1
7	P43358	1.46e-146	416	317	0.669	0.662	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
8	P43355	5.22e-131	377	309	0.646	0.657	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
9	P43361	1.75e-125	363	318	0.637	0.629	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
10	G5E962	2.93e-122	358	400	0.599	0.470	G5E962_HUMAN MAGE family member A11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=1
11	P43364	8.01e-122	358	429	0.599	0.438	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
12	P43362	2.17e-108	320	315	0.602	0.600	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
13	P43363	2.46e-95	288	369	0.516	0.439	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
14	C9J2X2	6.05e-75	234	295	0.408	0.434	C9J2X2_HUMAN MAGE family member A11 (Fragment) OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
15	Q96M61	1.06e-68	219	343	0.404	0.370	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
16	O15481	4.02e-65	210	346	0.392	0.355	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
17	O15480	8.63e-63	204	346	0.366	0.332	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
18	Q96LZ2	1.14e-58	193	347	0.309	0.280	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
19	Q8BQR7	1.94e-58	192	327	0.350	0.336	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1
20	Q9UBF1	3.03e-57	191	373	0.328	0.276	MAGC2_HUMAN Melanoma-associated antigen C2 OS=Homo sapiens OX=9606 GN=MAGEC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01454 MAGE	2.2e-13	62.0	MAGE homology domain
2	PF12440 MAGE_N	3.5e-23	93.4	Melanoma associated antigen family N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000473093

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253024	0.989	Transcription intermediary factor 1-beta
2	9606.ENSP00000355421	0.904	G antigen 2A
3	9606.ENSP00000404123	0.900	G antigen 12F
4	9606.ENSP00000359310	0.882	Putative chondrosarcoma-associated gene 1 protein
5	9606.ENSP00000469441	0.877	Cancer/testis antigen 1A
6	9606.ENSP00000332602	0.874	Cancer/testis antigen 1B
7	9606.ENSP00000448073	0.863	Pre-mRNA-processing factor 40 homolog B
8	9606.ENSP00000402758	0.855	Melanocyte protein PMEL
9	9606.ENSP00000484668	0.850	G antigen 1
10	9606.ENSP00000485185	0.834	Unknown. Candidate gene encoding tumor antigens
11	9606.ENSP00000480637	0.827	Melanoma-associated antigen 6
12	9606.ENSP00000446479	0.818	Adenosine monophosphate-protein transferase FICD
13	9606.ENSP00000445675	0.806	Melanoma antigen preferentially expressed in tumors
14	9606.ENSP00000263321	0.779	Tyrosinase
15	9606.ENSP00000377478	0.774	Melanoma-associated antigen 12
16	9606.ENSP00000485541	0.774	Melanoma-associated antigen 2
17	9606.ENSP00000483811	0.753	G antigen 13
18	9606.ENSP00000247306	0.743	Belongs to the CTAG/PCC1 family
19	9606.ENSP00000370886	0.730	Melanoma antigen recognized by T-cells 1
20	9606.ENSP00000338796	0.725	Synovial sarcoma, X breakpoint 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.992	regulation of metabolic process
GO:0048523	0.991	negative regulation of cellular process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0009895	0.974	negative regulation of catabolic process
GO:0031329	0.972	regulation of cellular catabolic process
GO:0010468	0.953	regulation of gene expression
GO:0010507	0.951	negative regulation of autophagy
GO:0051171	0.933	regulation of nitrogen compound metabolic process
GO:0009987	0.921	cellular process
GO:0050896	0.903	response to stimulus
GO:0080090	0.903	regulation of primary metabolic process
GO:0010605	0.898	negative regulation of macromolecule metabolic process
GO:0051172	0.895	negative regulation of nitrogen compound metabolic process
GO:0060548	0.873	negative regulation of cell death
GO:0048518	0.864	positive regulation of biological process
GO:0051246	0.843	regulation of protein metabolic process
GO:0042981	0.823	regulation of apoptotic process
GO:0051716	0.775	cellular response to stimulus
GO:0048583	0.763	regulation of response to stimulus
GO:0009893	0.723	positive regulation of metabolic process
GO:0048522	0.720	positive regulation of cellular process
GO:0010604	0.713	positive regulation of macromolecule metabolic process
GO:0051247	0.698	positive regulation of protein metabolic process
GO:0019219	0.696	regulation of nucleobase-containing compound metabolic process
GO:0050790	0.687	regulation of catalytic activity
GO:0051253	0.685	negative regulation of RNA metabolic process
GO:0008152	0.665	metabolic process
GO:0043066	0.641	negative regulation of apoptotic process
GO:0010646	0.633	regulation of cell communication
GO:0071704	0.630	organic substance metabolic process
GO:0048585	0.624	negative regulation of response to stimulus
GO:0051248	0.563	negative regulation of protein metabolic process
GO:0044238	0.561	primary metabolic process
GO:0009889	0.560	regulation of biosynthetic process
GO:0006807	0.520	nitrogen compound metabolic process
GO:0009966	0.510	regulation of signal transduction
GO:0080134	0.500	regulation of response to stress
GO:0031326	0.482	regulation of cellular biosynthetic process
GO:0023052	0.466	signaling
GO:0007154	0.465	cell communication
GO:0007165	0.458	signal transduction
GO:0010556	0.454	regulation of macromolecule biosynthetic process
GO:0006950	0.453	response to stress
GO:0031399	0.439	regulation of protein modification process
GO:0044237	0.430	cellular metabolic process
GO:0043170	0.369	macromolecule metabolic process
GO:1903317	0.364	regulation of protein maturation
GO:0010648	0.343	negative regulation of cell communication
GO:0010629	0.338	negative regulation of gene expression
GO:0006355	0.327	regulation of DNA-templated transcription
GO:1901564	0.303	organonitrogen compound metabolic process
GO:0080135	0.300	regulation of cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0005654	0.992	nucleoplasm
GO:0016020	0.978	membrane
GO:0012505	0.975	endomembrane system
GO:0071944	0.948	cell periphery
GO:0005886	0.938	plasma membrane
GO:0005829	0.697	cytosol
GO:0016604	0.432	nuclear body
GO:0005783	0.388	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]